Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FK30

Protein Details
Accession A0A5C5FK30    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
335-385AEKLVEMRRKRVDKKRKKLQRKVERAQRKKSKFKEGRRSPGKKRDPGRVDEBasic
NLS Segment(s)
PositionSequence
342-381RRKRVDKKRKKLQRKVERAQRKKSKFKEGRRSPGKKRDPG
Subcellular Location(s) cyto_mito 10, mito 9, cyto 9, nucl 7
Family & Domain DBs
Amino Acid Sequences MSAKPHKFWPSVGSVWSHWSDLLLATQLAALRAGFNYVGRYWAPSRPIHMWVRCTVETTAARTANCRHSLLSATAVDPKDPSGAWKVVGQDAGNLEAERHPKHTYPIGLSSWLKEEPTGCTTLQAGDTVTGFRELHNLEGSLRSDARRDGRFLARCKLRETKDTRHDFAFTCVLDTARCAFFVMFTRLLDTSDGQPQWRCVEIRSAHTCVSEALPPQERLKWRLKFFPPLQLEDGCTGRRTRIRKPASTGAAQHTGAVPVRERTIDDMHISTKSTLSRAGSSPRLVSLAATAAGSSDSNEPDPLAHDRTALSTAERELADATGSVKKLEADLAAAEKLVEMRRKRVDKKRKKLQRKVERAQRKKSKFKEGRRSPGKKRDPGRVDEGEQEVKAKGTAQALVLSDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.36
4 0.31
5 0.24
6 0.21
7 0.19
8 0.16
9 0.16
10 0.13
11 0.11
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.09
18 0.08
19 0.09
20 0.1
21 0.1
22 0.1
23 0.13
24 0.12
25 0.15
26 0.15
27 0.2
28 0.21
29 0.26
30 0.3
31 0.29
32 0.34
33 0.35
34 0.42
35 0.46
36 0.48
37 0.47
38 0.46
39 0.51
40 0.46
41 0.46
42 0.39
43 0.38
44 0.35
45 0.35
46 0.37
47 0.33
48 0.32
49 0.32
50 0.38
51 0.38
52 0.4
53 0.37
54 0.31
55 0.31
56 0.34
57 0.32
58 0.31
59 0.23
60 0.21
61 0.26
62 0.25
63 0.23
64 0.21
65 0.2
66 0.17
67 0.15
68 0.17
69 0.17
70 0.17
71 0.18
72 0.2
73 0.21
74 0.22
75 0.24
76 0.21
77 0.17
78 0.17
79 0.18
80 0.16
81 0.14
82 0.13
83 0.14
84 0.19
85 0.18
86 0.21
87 0.22
88 0.22
89 0.26
90 0.3
91 0.3
92 0.3
93 0.33
94 0.31
95 0.34
96 0.33
97 0.3
98 0.28
99 0.25
100 0.21
101 0.17
102 0.17
103 0.16
104 0.18
105 0.19
106 0.16
107 0.16
108 0.17
109 0.17
110 0.16
111 0.13
112 0.1
113 0.08
114 0.09
115 0.08
116 0.08
117 0.09
118 0.09
119 0.08
120 0.12
121 0.12
122 0.13
123 0.14
124 0.14
125 0.12
126 0.15
127 0.16
128 0.14
129 0.15
130 0.14
131 0.14
132 0.17
133 0.22
134 0.22
135 0.23
136 0.26
137 0.33
138 0.38
139 0.41
140 0.45
141 0.46
142 0.46
143 0.49
144 0.52
145 0.47
146 0.5
147 0.54
148 0.55
149 0.59
150 0.63
151 0.6
152 0.54
153 0.53
154 0.44
155 0.4
156 0.34
157 0.23
158 0.18
159 0.16
160 0.15
161 0.13
162 0.13
163 0.12
164 0.09
165 0.09
166 0.08
167 0.08
168 0.09
169 0.12
170 0.15
171 0.13
172 0.13
173 0.14
174 0.14
175 0.15
176 0.14
177 0.12
178 0.1
179 0.14
180 0.15
181 0.14
182 0.15
183 0.16
184 0.16
185 0.17
186 0.16
187 0.11
188 0.19
189 0.2
190 0.25
191 0.28
192 0.29
193 0.28
194 0.27
195 0.27
196 0.2
197 0.19
198 0.15
199 0.11
200 0.12
201 0.15
202 0.16
203 0.17
204 0.21
205 0.22
206 0.25
207 0.34
208 0.37
209 0.37
210 0.44
211 0.46
212 0.51
213 0.5
214 0.55
215 0.48
216 0.45
217 0.45
218 0.37
219 0.35
220 0.28
221 0.28
222 0.19
223 0.17
224 0.14
225 0.15
226 0.2
227 0.24
228 0.3
229 0.38
230 0.45
231 0.48
232 0.55
233 0.59
234 0.58
235 0.56
236 0.52
237 0.45
238 0.42
239 0.38
240 0.31
241 0.24
242 0.21
243 0.19
244 0.16
245 0.13
246 0.1
247 0.11
248 0.11
249 0.12
250 0.14
251 0.16
252 0.16
253 0.17
254 0.17
255 0.18
256 0.18
257 0.19
258 0.15
259 0.15
260 0.14
261 0.13
262 0.15
263 0.15
264 0.17
265 0.18
266 0.23
267 0.25
268 0.25
269 0.25
270 0.23
271 0.22
272 0.19
273 0.17
274 0.13
275 0.1
276 0.09
277 0.08
278 0.07
279 0.06
280 0.07
281 0.07
282 0.07
283 0.08
284 0.09
285 0.1
286 0.1
287 0.1
288 0.1
289 0.13
290 0.15
291 0.17
292 0.16
293 0.16
294 0.16
295 0.18
296 0.2
297 0.17
298 0.15
299 0.13
300 0.13
301 0.16
302 0.15
303 0.14
304 0.13
305 0.12
306 0.11
307 0.1
308 0.12
309 0.12
310 0.13
311 0.13
312 0.12
313 0.12
314 0.13
315 0.14
316 0.12
317 0.09
318 0.1
319 0.12
320 0.11
321 0.11
322 0.1
323 0.09
324 0.11
325 0.15
326 0.21
327 0.21
328 0.29
329 0.38
330 0.48
331 0.57
332 0.66
333 0.73
334 0.77
335 0.86
336 0.9
337 0.92
338 0.94
339 0.95
340 0.95
341 0.95
342 0.95
343 0.94
344 0.94
345 0.94
346 0.93
347 0.93
348 0.93
349 0.92
350 0.91
351 0.89
352 0.89
353 0.88
354 0.9
355 0.9
356 0.9
357 0.91
358 0.91
359 0.93
360 0.92
361 0.93
362 0.92
363 0.9
364 0.85
365 0.85
366 0.82
367 0.78
368 0.76
369 0.72
370 0.65
371 0.61
372 0.6
373 0.53
374 0.46
375 0.41
376 0.33
377 0.27
378 0.24
379 0.2
380 0.18
381 0.17
382 0.18
383 0.18
384 0.21
385 0.21