Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FWX8

Protein Details
Accession A0A5C5FWX8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-52SLNPKHKQVRPSSRRVPPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences DAARGFKVRSSVKLMCSGCQSVKRKGTVFILCSLNPKHKQVRPSSRRVPPSPALLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.38
4 0.37
5 0.32
6 0.37
7 0.39
8 0.38
9 0.42
10 0.43
11 0.4
12 0.4
13 0.43
14 0.37
15 0.34
16 0.31
17 0.29
18 0.26
19 0.29
20 0.28
21 0.3
22 0.3
23 0.34
24 0.38
25 0.39
26 0.46
27 0.53
28 0.63
29 0.63
30 0.69
31 0.74
32 0.75
33 0.8
34 0.76
35 0.74
36 0.67