Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0IMV3

Protein Details
Accession A0A4T0IMV3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-103ENAPQKPCVPRQSHKRRYLQWKAELFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007220  ORC2  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003688  F:DNA replication origin binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF04084  ORC2  
Amino Acid Sequences MQLLPDDGKIQPINSEDDWGSEDNEDLTNSTDATPSKPIITPTTSDVYFQYQNIPARPSNSLFPYPPLTAKETRTALENAPQKPCVPRQSHKRRYLQWKAELFLLHRPLIFTGFGSKRGAIDDFVRELSGEYDVITIDAFNPSITFRGVLEGLLAVHQKSSIPSSTPTDELMRSVQLHYSRASTPRIVAVLHSMDALTLHARKNVDVDKLKRVLGSERISVVASVDHLNAPLLFPAHDAAVGLPWLWHDLSTLEPHLMEMAQRATSLLHSSQAASSTGIVPTVSGARHVIASVPDRARRLFVAIAQLQLERCSEGEKSDATAQNTSTTLTPSHASPRHALVSMAKQSFIATSEDAFEAALAEFRDHGLIQSSSSPPSNTHVDGPEQYIWIPLDQRSLRRTLEDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.22
4 0.23
5 0.26
6 0.23
7 0.22
8 0.17
9 0.17
10 0.14
11 0.15
12 0.14
13 0.11
14 0.13
15 0.12
16 0.13
17 0.13
18 0.14
19 0.14
20 0.17
21 0.2
22 0.19
23 0.21
24 0.23
25 0.25
26 0.27
27 0.3
28 0.29
29 0.29
30 0.33
31 0.3
32 0.29
33 0.28
34 0.28
35 0.27
36 0.26
37 0.26
38 0.27
39 0.31
40 0.33
41 0.36
42 0.32
43 0.33
44 0.37
45 0.34
46 0.34
47 0.35
48 0.36
49 0.33
50 0.34
51 0.36
52 0.34
53 0.35
54 0.33
55 0.33
56 0.33
57 0.35
58 0.39
59 0.36
60 0.35
61 0.35
62 0.35
63 0.31
64 0.34
65 0.38
66 0.35
67 0.37
68 0.38
69 0.36
70 0.39
71 0.44
72 0.45
73 0.46
74 0.5
75 0.58
76 0.68
77 0.77
78 0.81
79 0.83
80 0.83
81 0.86
82 0.88
83 0.86
84 0.84
85 0.78
86 0.69
87 0.64
88 0.56
89 0.47
90 0.43
91 0.38
92 0.29
93 0.25
94 0.24
95 0.21
96 0.21
97 0.19
98 0.13
99 0.17
100 0.17
101 0.2
102 0.21
103 0.2
104 0.19
105 0.21
106 0.21
107 0.15
108 0.16
109 0.16
110 0.16
111 0.16
112 0.16
113 0.14
114 0.13
115 0.13
116 0.11
117 0.08
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.04
125 0.05
126 0.05
127 0.04
128 0.05
129 0.05
130 0.06
131 0.07
132 0.07
133 0.06
134 0.08
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.08
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.09
148 0.09
149 0.1
150 0.12
151 0.16
152 0.17
153 0.18
154 0.19
155 0.18
156 0.17
157 0.17
158 0.16
159 0.14
160 0.13
161 0.12
162 0.14
163 0.14
164 0.15
165 0.14
166 0.16
167 0.16
168 0.18
169 0.2
170 0.18
171 0.17
172 0.17
173 0.17
174 0.14
175 0.12
176 0.12
177 0.11
178 0.1
179 0.09
180 0.08
181 0.07
182 0.07
183 0.07
184 0.06
185 0.07
186 0.07
187 0.1
188 0.1
189 0.11
190 0.14
191 0.16
192 0.21
193 0.25
194 0.27
195 0.31
196 0.33
197 0.33
198 0.3
199 0.29
200 0.25
201 0.26
202 0.26
203 0.21
204 0.2
205 0.2
206 0.2
207 0.19
208 0.16
209 0.09
210 0.08
211 0.07
212 0.07
213 0.06
214 0.06
215 0.07
216 0.06
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.04
230 0.04
231 0.04
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.07
238 0.09
239 0.1
240 0.09
241 0.09
242 0.09
243 0.09
244 0.08
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.1
254 0.09
255 0.09
256 0.09
257 0.1
258 0.11
259 0.12
260 0.12
261 0.1
262 0.1
263 0.1
264 0.1
265 0.09
266 0.08
267 0.07
268 0.07
269 0.08
270 0.08
271 0.08
272 0.08
273 0.08
274 0.09
275 0.09
276 0.09
277 0.1
278 0.13
279 0.18
280 0.21
281 0.24
282 0.26
283 0.26
284 0.27
285 0.25
286 0.26
287 0.21
288 0.19
289 0.24
290 0.23
291 0.24
292 0.23
293 0.23
294 0.2
295 0.2
296 0.18
297 0.11
298 0.1
299 0.11
300 0.11
301 0.11
302 0.13
303 0.12
304 0.15
305 0.21
306 0.25
307 0.26
308 0.27
309 0.26
310 0.27
311 0.26
312 0.24
313 0.18
314 0.15
315 0.14
316 0.14
317 0.14
318 0.14
319 0.23
320 0.26
321 0.28
322 0.29
323 0.33
324 0.34
325 0.33
326 0.32
327 0.28
328 0.32
329 0.37
330 0.36
331 0.31
332 0.28
333 0.28
334 0.28
335 0.25
336 0.19
337 0.12
338 0.12
339 0.14
340 0.14
341 0.14
342 0.13
343 0.11
344 0.09
345 0.08
346 0.1
347 0.08
348 0.08
349 0.08
350 0.09
351 0.11
352 0.09
353 0.1
354 0.13
355 0.12
356 0.14
357 0.18
358 0.2
359 0.21
360 0.23
361 0.23
362 0.21
363 0.25
364 0.29
365 0.26
366 0.29
367 0.29
368 0.32
369 0.33
370 0.36
371 0.33
372 0.29
373 0.27
374 0.26
375 0.24
376 0.21
377 0.22
378 0.18
379 0.26
380 0.29
381 0.34
382 0.35
383 0.4
384 0.39
385 0.4