Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0LKS6

Protein Details
Accession A0A4T0LKS6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-96SESKTIKKIEKLQKTKKNAAKKTKRKYASISHydrophilic
NLS Segment(s)
PositionSequence
72-91KKIEKLQKTKKNAAKKTKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MDLIEKFVKGQGKGGQAVNKTSNKVFLQHAPSGLSVECHATRSLTSNRSQARKLLQDKYNSIYNPSESKTIKKIEKLQKTKKNAAKKTKRKYASISHNDIEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.35
4 0.4
5 0.42
6 0.39
7 0.37
8 0.34
9 0.37
10 0.32
11 0.33
12 0.31
13 0.31
14 0.33
15 0.32
16 0.33
17 0.28
18 0.27
19 0.25
20 0.22
21 0.16
22 0.11
23 0.12
24 0.12
25 0.11
26 0.11
27 0.11
28 0.11
29 0.15
30 0.19
31 0.19
32 0.21
33 0.26
34 0.31
35 0.33
36 0.34
37 0.32
38 0.32
39 0.37
40 0.4
41 0.41
42 0.41
43 0.42
44 0.43
45 0.43
46 0.43
47 0.36
48 0.33
49 0.27
50 0.25
51 0.23
52 0.23
53 0.25
54 0.22
55 0.25
56 0.27
57 0.33
58 0.35
59 0.38
60 0.47
61 0.51
62 0.61
63 0.68
64 0.73
65 0.76
66 0.81
67 0.85
68 0.83
69 0.84
70 0.83
71 0.84
72 0.85
73 0.86
74 0.88
75 0.89
76 0.87
77 0.82
78 0.79
79 0.79
80 0.79
81 0.77
82 0.74
83 0.66