Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0J1Y4

Protein Details
Accession A0A4T0J1Y4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
463-485IPGAPSPKPPPQRKEKDNASQASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011387  TIF2A  
IPR013979  TIF_beta_prop-like  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08662  eIF2A  
Amino Acid Sequences MQLEYGLRSLKDLKLIKNFTNLFDLPAEVKIFKYSNCGQYLAYALSDSVIIANSAGSTLSQLNIKQCQDLQFSCKSTYLQTWTRSVRLDNQDFSENVEIWSLDGTKQFSTTVKQIENWTLNFTSDDKYAVKQQSNEILVYDTANWSKGFTNKLKVDGMITYSLSPGQNPHLATFIAEKKGAPASLRLYSLVGLSNSSKTVSQKTFFKADRVMMKWNDIGTTLLFQTQTDFDKTNKNYYGESNLYLLSTIGGGYDARITLDKPGPIHDFNWSPNSKEFIVIYGYMPAKATLFDQRGNPTFDFGTNPRNFTLFNPQARFILIAGFGNLAGQVDIWDRKSLKKVCQIDCSNTSHCEWSPDGRFILTATCSPRLRVDNGVKVWHLTGKLIDIKPIEELYQVHWRPQDVSNFPDFKSEIEPPPTPNQSVIQYQNPSDSKPKITGAYKPPHARGTPSSSGTSTPKSKQIPGAPSPKPPPQRKEKDNASQASQASASAQNDQLTPVDKKVRNLTKKLKAIEELKDKQNKGEKLEKTQLAKLDSEEEITKEIAQLKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.51
4 0.57
5 0.56
6 0.5
7 0.52
8 0.45
9 0.38
10 0.33
11 0.32
12 0.24
13 0.25
14 0.25
15 0.18
16 0.18
17 0.2
18 0.21
19 0.19
20 0.25
21 0.29
22 0.34
23 0.36
24 0.37
25 0.32
26 0.33
27 0.35
28 0.29
29 0.23
30 0.16
31 0.13
32 0.12
33 0.12
34 0.1
35 0.07
36 0.06
37 0.06
38 0.05
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.07
46 0.08
47 0.11
48 0.13
49 0.19
50 0.25
51 0.26
52 0.27
53 0.29
54 0.33
55 0.36
56 0.37
57 0.37
58 0.37
59 0.39
60 0.38
61 0.37
62 0.33
63 0.31
64 0.33
65 0.36
66 0.36
67 0.37
68 0.42
69 0.44
70 0.46
71 0.45
72 0.42
73 0.44
74 0.47
75 0.49
76 0.44
77 0.44
78 0.44
79 0.42
80 0.43
81 0.36
82 0.27
83 0.22
84 0.2
85 0.16
86 0.13
87 0.14
88 0.11
89 0.09
90 0.12
91 0.13
92 0.13
93 0.14
94 0.15
95 0.15
96 0.18
97 0.22
98 0.25
99 0.25
100 0.27
101 0.3
102 0.36
103 0.38
104 0.35
105 0.35
106 0.3
107 0.28
108 0.27
109 0.25
110 0.21
111 0.17
112 0.19
113 0.16
114 0.17
115 0.24
116 0.28
117 0.3
118 0.3
119 0.33
120 0.37
121 0.38
122 0.36
123 0.29
124 0.25
125 0.22
126 0.2
127 0.17
128 0.12
129 0.11
130 0.12
131 0.12
132 0.12
133 0.14
134 0.16
135 0.22
136 0.24
137 0.32
138 0.33
139 0.36
140 0.36
141 0.34
142 0.32
143 0.27
144 0.25
145 0.18
146 0.17
147 0.13
148 0.13
149 0.14
150 0.13
151 0.12
152 0.11
153 0.13
154 0.16
155 0.16
156 0.16
157 0.16
158 0.16
159 0.16
160 0.2
161 0.2
162 0.19
163 0.18
164 0.17
165 0.18
166 0.2
167 0.2
168 0.15
169 0.15
170 0.17
171 0.19
172 0.2
173 0.18
174 0.17
175 0.16
176 0.16
177 0.15
178 0.11
179 0.1
180 0.1
181 0.1
182 0.1
183 0.11
184 0.12
185 0.12
186 0.18
187 0.2
188 0.22
189 0.26
190 0.29
191 0.36
192 0.35
193 0.36
194 0.33
195 0.34
196 0.37
197 0.35
198 0.38
199 0.31
200 0.32
201 0.31
202 0.28
203 0.24
204 0.18
205 0.16
206 0.11
207 0.11
208 0.09
209 0.09
210 0.08
211 0.08
212 0.09
213 0.1
214 0.11
215 0.12
216 0.13
217 0.13
218 0.22
219 0.23
220 0.28
221 0.3
222 0.29
223 0.29
224 0.29
225 0.33
226 0.27
227 0.26
228 0.21
229 0.18
230 0.16
231 0.15
232 0.13
233 0.07
234 0.06
235 0.04
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.08
246 0.11
247 0.12
248 0.11
249 0.15
250 0.18
251 0.18
252 0.19
253 0.18
254 0.18
255 0.19
256 0.25
257 0.23
258 0.21
259 0.21
260 0.24
261 0.21
262 0.2
263 0.18
264 0.13
265 0.14
266 0.12
267 0.11
268 0.12
269 0.12
270 0.11
271 0.11
272 0.1
273 0.09
274 0.09
275 0.1
276 0.11
277 0.13
278 0.15
279 0.17
280 0.2
281 0.23
282 0.26
283 0.24
284 0.2
285 0.19
286 0.18
287 0.19
288 0.17
289 0.24
290 0.21
291 0.23
292 0.22
293 0.22
294 0.22
295 0.21
296 0.3
297 0.27
298 0.31
299 0.32
300 0.32
301 0.32
302 0.31
303 0.3
304 0.2
305 0.15
306 0.1
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.06
313 0.04
314 0.03
315 0.03
316 0.04
317 0.05
318 0.07
319 0.08
320 0.11
321 0.12
322 0.14
323 0.23
324 0.27
325 0.32
326 0.39
327 0.47
328 0.48
329 0.57
330 0.58
331 0.55
332 0.55
333 0.53
334 0.47
335 0.4
336 0.37
337 0.3
338 0.27
339 0.25
340 0.22
341 0.22
342 0.23
343 0.23
344 0.23
345 0.2
346 0.2
347 0.17
348 0.18
349 0.13
350 0.13
351 0.14
352 0.19
353 0.2
354 0.21
355 0.25
356 0.26
357 0.27
358 0.32
359 0.35
360 0.37
361 0.39
362 0.4
363 0.36
364 0.34
365 0.32
366 0.27
367 0.21
368 0.14
369 0.13
370 0.14
371 0.21
372 0.2
373 0.23
374 0.21
375 0.21
376 0.21
377 0.21
378 0.18
379 0.13
380 0.13
381 0.14
382 0.24
383 0.24
384 0.25
385 0.26
386 0.26
387 0.28
388 0.32
389 0.36
390 0.28
391 0.32
392 0.36
393 0.37
394 0.36
395 0.37
396 0.33
397 0.26
398 0.28
399 0.28
400 0.26
401 0.29
402 0.31
403 0.31
404 0.38
405 0.4
406 0.36
407 0.33
408 0.31
409 0.29
410 0.33
411 0.34
412 0.33
413 0.33
414 0.32
415 0.38
416 0.36
417 0.36
418 0.37
419 0.36
420 0.32
421 0.33
422 0.35
423 0.34
424 0.36
425 0.41
426 0.44
427 0.5
428 0.55
429 0.57
430 0.58
431 0.59
432 0.57
433 0.53
434 0.5
435 0.5
436 0.47
437 0.45
438 0.43
439 0.38
440 0.4
441 0.39
442 0.39
443 0.37
444 0.34
445 0.39
446 0.4
447 0.43
448 0.47
449 0.51
450 0.53
451 0.55
452 0.61
453 0.57
454 0.61
455 0.63
456 0.64
457 0.67
458 0.68
459 0.69
460 0.7
461 0.78
462 0.77
463 0.81
464 0.82
465 0.83
466 0.83
467 0.78
468 0.72
469 0.67
470 0.6
471 0.52
472 0.42
473 0.32
474 0.26
475 0.26
476 0.22
477 0.2
478 0.22
479 0.21
480 0.21
481 0.22
482 0.21
483 0.21
484 0.22
485 0.25
486 0.32
487 0.34
488 0.39
489 0.48
490 0.57
491 0.61
492 0.69
493 0.73
494 0.74
495 0.79
496 0.78
497 0.74
498 0.7
499 0.68
500 0.67
501 0.67
502 0.64
503 0.65
504 0.69
505 0.64
506 0.65
507 0.68
508 0.63
509 0.6
510 0.63
511 0.6
512 0.6
513 0.69
514 0.68
515 0.63
516 0.64
517 0.62
518 0.56
519 0.51
520 0.43
521 0.38
522 0.32
523 0.31
524 0.27
525 0.23
526 0.22
527 0.21
528 0.2
529 0.19