Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V4M2K2

Protein Details
Accession A0A4V4M2K2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-27LTLTKALKDKKPKSQIHKHCDKLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MAPLTLTKALKDKKPKSQIHKHCDKLSYIALLSFLQRTAMETRIVSQEIHGHDNNRLMTRREVGRAGRRVLRRVNGNQEQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.77
4 0.83
5 0.85
6 0.84
7 0.87
8 0.83
9 0.78
10 0.72
11 0.63
12 0.56
13 0.47
14 0.39
15 0.29
16 0.22
17 0.18
18 0.15
19 0.14
20 0.11
21 0.09
22 0.07
23 0.07
24 0.09
25 0.1
26 0.11
27 0.11
28 0.1
29 0.12
30 0.13
31 0.14
32 0.12
33 0.11
34 0.13
35 0.15
36 0.19
37 0.19
38 0.18
39 0.19
40 0.23
41 0.25
42 0.24
43 0.25
44 0.23
45 0.25
46 0.29
47 0.31
48 0.3
49 0.32
50 0.36
51 0.43
52 0.46
53 0.48
54 0.51
55 0.53
56 0.56
57 0.58
58 0.59
59 0.58
60 0.6
61 0.65