Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0JJM6

Protein Details
Accession A0A4T0JJM6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
121-152PQTQPQKKEAPSHRQRRRDQHSKNHNNQPKMGHydrophilic
NLS Segment(s)
PositionSequence
93-110PKKARRSERDKPEGSIKR
134-137RQRR
Subcellular Location(s) cyto_nucl 8.5, mito 10, mito_nucl 10.166, nucl 10
Family & Domain DBs
Amino Acid Sequences MPSLIAAAMVETKSKGQPMQDRKGFSVARRAGKGAYTGKGGLRAIELYDPDTLTPPTASKIKEQLIQKAKVKKEYANMLKKEGQPAQQLPEIPKKARRSERDKPEGSIKRSDNPQQKQPQPQTQPQKKEAPSHRQRRRDQHSKNHNNQPKMGARMQTMLDKVKKTVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.23
4 0.32
5 0.41
6 0.5
7 0.53
8 0.56
9 0.55
10 0.61
11 0.57
12 0.49
13 0.5
14 0.47
15 0.47
16 0.45
17 0.44
18 0.38
19 0.36
20 0.4
21 0.33
22 0.28
23 0.24
24 0.24
25 0.23
26 0.26
27 0.25
28 0.19
29 0.16
30 0.14
31 0.13
32 0.13
33 0.13
34 0.11
35 0.11
36 0.11
37 0.1
38 0.11
39 0.11
40 0.1
41 0.1
42 0.09
43 0.11
44 0.14
45 0.15
46 0.16
47 0.22
48 0.23
49 0.28
50 0.3
51 0.36
52 0.4
53 0.44
54 0.47
55 0.49
56 0.5
57 0.51
58 0.51
59 0.45
60 0.43
61 0.46
62 0.5
63 0.51
64 0.49
65 0.47
66 0.5
67 0.48
68 0.47
69 0.4
70 0.35
71 0.3
72 0.3
73 0.28
74 0.25
75 0.25
76 0.24
77 0.3
78 0.29
79 0.27
80 0.33
81 0.35
82 0.42
83 0.49
84 0.54
85 0.55
86 0.62
87 0.71
88 0.74
89 0.7
90 0.64
91 0.66
92 0.66
93 0.6
94 0.58
95 0.5
96 0.45
97 0.49
98 0.55
99 0.54
100 0.52
101 0.57
102 0.59
103 0.63
104 0.68
105 0.71
106 0.72
107 0.69
108 0.73
109 0.75
110 0.75
111 0.76
112 0.72
113 0.73
114 0.67
115 0.7
116 0.7
117 0.7
118 0.72
119 0.75
120 0.79
121 0.8
122 0.85
123 0.86
124 0.88
125 0.88
126 0.87
127 0.87
128 0.89
129 0.9
130 0.9
131 0.91
132 0.89
133 0.83
134 0.76
135 0.73
136 0.69
137 0.64
138 0.59
139 0.52
140 0.46
141 0.45
142 0.43
143 0.41
144 0.37
145 0.39
146 0.39
147 0.37