Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0IDA6

Protein Details
Accession A0A4T0IDA6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79QVGHKHSTKKHPQLKHQLKDBasic
159-178NNQFTRKKAGRNHKNYHLSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
Amino Acid Sequences ESIPIEDLVKICLSKLPTIKNLRLHFLQDDIRKFSKIDDFNPTQNTRINSIETLTLRAIQVGHKHSTKKHPQLKHQLKDVSENVAKFDDHLEATRMFRFGSEIVIDGDKTLMLGRVYEIDPPSYEHSSATRLFSTSQPAYKFGLRNHKGAAARWKAIGNNQFTRKKAGRNHKNYHLSPEQTNRLANGALAHGTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.31
4 0.38
5 0.46
6 0.52
7 0.57
8 0.57
9 0.57
10 0.54
11 0.52
12 0.44
13 0.41
14 0.42
15 0.4
16 0.41
17 0.41
18 0.41
19 0.38
20 0.37
21 0.36
22 0.37
23 0.34
24 0.34
25 0.36
26 0.38
27 0.42
28 0.48
29 0.46
30 0.4
31 0.4
32 0.39
33 0.33
34 0.31
35 0.29
36 0.23
37 0.22
38 0.25
39 0.21
40 0.21
41 0.18
42 0.18
43 0.15
44 0.15
45 0.15
46 0.13
47 0.17
48 0.19
49 0.22
50 0.25
51 0.28
52 0.32
53 0.41
54 0.49
55 0.54
56 0.59
57 0.61
58 0.68
59 0.76
60 0.82
61 0.77
62 0.75
63 0.69
64 0.61
65 0.6
66 0.51
67 0.46
68 0.37
69 0.32
70 0.26
71 0.23
72 0.21
73 0.16
74 0.16
75 0.11
76 0.09
77 0.09
78 0.1
79 0.1
80 0.11
81 0.12
82 0.11
83 0.1
84 0.09
85 0.1
86 0.08
87 0.08
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.05
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.07
103 0.08
104 0.1
105 0.11
106 0.1
107 0.11
108 0.13
109 0.17
110 0.16
111 0.16
112 0.14
113 0.15
114 0.18
115 0.19
116 0.19
117 0.15
118 0.15
119 0.16
120 0.17
121 0.22
122 0.21
123 0.24
124 0.23
125 0.25
126 0.27
127 0.3
128 0.33
129 0.32
130 0.4
131 0.39
132 0.4
133 0.4
134 0.43
135 0.4
136 0.41
137 0.45
138 0.4
139 0.39
140 0.38
141 0.39
142 0.34
143 0.39
144 0.41
145 0.38
146 0.4
147 0.48
148 0.51
149 0.51
150 0.58
151 0.55
152 0.57
153 0.6
154 0.63
155 0.66
156 0.7
157 0.78
158 0.8
159 0.85
160 0.79
161 0.77
162 0.74
163 0.67
164 0.64
165 0.64
166 0.6
167 0.54
168 0.53
169 0.46
170 0.4
171 0.36
172 0.29
173 0.22
174 0.17