Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0FKT6

Protein Details
Accession A0A4T0FKT6   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-64GKGGAKSKKKWSKGKVKDKAQNABasic
NLS Segment(s)
PositionSequence
42-59GKGGAKSKKKWSKGKVKD
Subcellular Location(s) cyto 5, mito 19, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPRSYFTLTWNKFFSQPFHFFHSELPFFSDTVAASAANPSAGKGGAKSKKKWSKGKVKDKAQNAVVLDRPTYDRILKEVPTFKMISQSTLIDRMKINGSLARIAIRHLHREGAIRQIVHHNGQYIYTRGSQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.42
4 0.4
5 0.44
6 0.44
7 0.4
8 0.42
9 0.45
10 0.38
11 0.32
12 0.32
13 0.26
14 0.24
15 0.24
16 0.2
17 0.12
18 0.12
19 0.12
20 0.08
21 0.07
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.07
30 0.07
31 0.16
32 0.24
33 0.3
34 0.34
35 0.44
36 0.52
37 0.61
38 0.69
39 0.69
40 0.73
41 0.78
42 0.85
43 0.84
44 0.85
45 0.83
46 0.78
47 0.75
48 0.64
49 0.57
50 0.46
51 0.39
52 0.31
53 0.25
54 0.2
55 0.15
56 0.15
57 0.13
58 0.14
59 0.13
60 0.11
61 0.14
62 0.16
63 0.17
64 0.2
65 0.23
66 0.23
67 0.24
68 0.25
69 0.22
70 0.27
71 0.26
72 0.24
73 0.21
74 0.21
75 0.19
76 0.25
77 0.25
78 0.2
79 0.2
80 0.2
81 0.2
82 0.2
83 0.2
84 0.15
85 0.16
86 0.16
87 0.16
88 0.16
89 0.14
90 0.15
91 0.21
92 0.22
93 0.25
94 0.25
95 0.27
96 0.27
97 0.32
98 0.32
99 0.33
100 0.34
101 0.29
102 0.3
103 0.35
104 0.37
105 0.35
106 0.35
107 0.3
108 0.27
109 0.29
110 0.3
111 0.26
112 0.25