Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0IPG3

Protein Details
Accession A0A4T0IPG3   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-37DSGLKRKKKSSAQTAPKDNAHydrophilic
NLS Segment(s)
PositionSequence
19-26SGLKRKKK
Subcellular Location(s) cyto_nucl 13, nucl 24.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MPDDYSFKPTKGLKFKNDSGLKRKKKSSAQTAPKDNAIGPSGSGDSPHTTRSTQDTRTESEIKFDHIQRQRLHHKVKNNAKLSHKDKVDEFNKKLENLTEHNDLPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.7
4 0.73
5 0.71
6 0.71
7 0.74
8 0.75
9 0.74
10 0.76
11 0.74
12 0.75
13 0.78
14 0.78
15 0.78
16 0.79
17 0.8
18 0.81
19 0.75
20 0.67
21 0.58
22 0.48
23 0.39
24 0.3
25 0.21
26 0.13
27 0.12
28 0.12
29 0.1
30 0.11
31 0.09
32 0.11
33 0.11
34 0.13
35 0.13
36 0.12
37 0.13
38 0.19
39 0.22
40 0.22
41 0.27
42 0.28
43 0.29
44 0.34
45 0.36
46 0.3
47 0.3
48 0.27
49 0.25
50 0.27
51 0.26
52 0.3
53 0.32
54 0.39
55 0.37
56 0.45
57 0.5
58 0.55
59 0.62
60 0.58
61 0.6
62 0.64
63 0.72
64 0.74
65 0.72
66 0.7
67 0.68
68 0.73
69 0.7
70 0.68
71 0.6
72 0.53
73 0.49
74 0.52
75 0.54
76 0.54
77 0.51
78 0.51
79 0.52
80 0.5
81 0.5
82 0.44
83 0.41
84 0.36
85 0.39
86 0.36
87 0.34
88 0.36
89 0.35
90 0.32