Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V4LQL4

Protein Details
Accession A0A4V4LQL4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-30DARRVQLRKPNPYNTKSNKRRVIKTPGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVDARRVQLRKPNPYNTKSNKRRVIKTPGWSILAQRRLLTSANRWTIALLAHPQEANRSKVPALRPRGYATISKRQKSVTRAYGGSRCAHCVRERIVRAFLVEEAKIVKKVIKSQTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.8
4 0.82
5 0.81
6 0.83
7 0.82
8 0.81
9 0.83
10 0.8
11 0.8
12 0.77
13 0.75
14 0.73
15 0.67
16 0.62
17 0.55
18 0.52
19 0.49
20 0.47
21 0.4
22 0.32
23 0.29
24 0.27
25 0.29
26 0.26
27 0.24
28 0.26
29 0.28
30 0.28
31 0.27
32 0.25
33 0.24
34 0.22
35 0.18
36 0.12
37 0.1
38 0.1
39 0.11
40 0.1
41 0.15
42 0.17
43 0.19
44 0.18
45 0.18
46 0.18
47 0.21
48 0.27
49 0.29
50 0.34
51 0.33
52 0.35
53 0.36
54 0.38
55 0.36
56 0.37
57 0.35
58 0.38
59 0.43
60 0.42
61 0.41
62 0.43
63 0.46
64 0.46
65 0.48
66 0.45
67 0.42
68 0.42
69 0.45
70 0.45
71 0.43
72 0.43
73 0.35
74 0.33
75 0.31
76 0.32
77 0.31
78 0.32
79 0.34
80 0.39
81 0.42
82 0.41
83 0.42
84 0.4
85 0.38
86 0.35
87 0.32
88 0.25
89 0.2
90 0.17
91 0.18
92 0.19
93 0.19
94 0.18
95 0.2
96 0.2
97 0.29
98 0.37