Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0IKS6

Protein Details
Accession A0A4T0IKS6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
381-407VAPAAPQQAQKKRKKAGSSNRRVKITNHydrophilic
NLS Segment(s)
PositionSequence
391-401KKRKKAGSSNR
Subcellular Location(s) E.R. 3, extr 9, golg 7, mito 3, vacu 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
IPR003166  TFIIE_bsu_DNA-bd  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0003677  F:DNA binding  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
PF02186  TFIIE_beta  
PROSITE View protein in PROSITE  
PS51351  TFIIE_BETA_C  
Amino Acid Sequences MKLTYIVGLLAVTVLASAKMEVKRGADQNGSLDKAIQSGQWIEDLWGAGNYPNNGESKGESKQPEEGKKEGNENKESSEPSKQPEDNKKETPAKQPEENQKESPKEPESGNKEKGSQGQKDKCGYTPEEKEKSLQAQAQAFRKKVASQQPQAWGGVESRSPSVAPTPGAGANGDDGIPIAGSQQAAAAAAARRKKNNEIFSQPRDTGVGMHINSQLAYLVQFIKDYNAPIRLEDLIVRSGIELIRTPGLLDLFNSHDRVQHDTKLDLYSYRHDFPMKSKAELLAHVKAYAPRGGMRVNILKESWPGAPQAIDELEREKEIIVLRGKDGQGMRTVFENNVKDAIEVQDEFRGLWNSLNVPVESEVARDLDDAGLKRTSKTEVAPAAPQQAQKKRKKAGSSNRRVKITNTHLQEQGIDLSKDFVPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.11
6 0.13
7 0.16
8 0.19
9 0.22
10 0.29
11 0.32
12 0.37
13 0.34
14 0.34
15 0.38
16 0.41
17 0.4
18 0.33
19 0.3
20 0.26
21 0.24
22 0.23
23 0.17
24 0.14
25 0.14
26 0.15
27 0.14
28 0.14
29 0.14
30 0.15
31 0.15
32 0.13
33 0.11
34 0.11
35 0.11
36 0.14
37 0.14
38 0.13
39 0.15
40 0.16
41 0.16
42 0.17
43 0.18
44 0.19
45 0.22
46 0.27
47 0.27
48 0.28
49 0.35
50 0.42
51 0.47
52 0.48
53 0.49
54 0.49
55 0.5
56 0.57
57 0.56
58 0.56
59 0.53
60 0.49
61 0.49
62 0.47
63 0.47
64 0.41
65 0.43
66 0.38
67 0.37
68 0.44
69 0.43
70 0.48
71 0.56
72 0.61
73 0.59
74 0.62
75 0.65
76 0.66
77 0.68
78 0.69
79 0.68
80 0.65
81 0.64
82 0.68
83 0.71
84 0.7
85 0.7
86 0.65
87 0.63
88 0.62
89 0.57
90 0.56
91 0.47
92 0.42
93 0.39
94 0.42
95 0.43
96 0.47
97 0.5
98 0.45
99 0.45
100 0.44
101 0.5
102 0.48
103 0.48
104 0.5
105 0.52
106 0.56
107 0.58
108 0.57
109 0.52
110 0.5
111 0.46
112 0.44
113 0.45
114 0.48
115 0.49
116 0.48
117 0.47
118 0.45
119 0.44
120 0.41
121 0.34
122 0.29
123 0.3
124 0.34
125 0.4
126 0.42
127 0.39
128 0.37
129 0.36
130 0.33
131 0.35
132 0.41
133 0.42
134 0.42
135 0.47
136 0.5
137 0.51
138 0.49
139 0.42
140 0.33
141 0.25
142 0.21
143 0.16
144 0.12
145 0.11
146 0.11
147 0.1
148 0.1
149 0.11
150 0.11
151 0.1
152 0.09
153 0.11
154 0.11
155 0.11
156 0.11
157 0.09
158 0.08
159 0.08
160 0.07
161 0.05
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.06
176 0.1
177 0.15
178 0.17
179 0.2
180 0.23
181 0.31
182 0.37
183 0.41
184 0.43
185 0.47
186 0.51
187 0.54
188 0.56
189 0.48
190 0.41
191 0.36
192 0.3
193 0.22
194 0.17
195 0.16
196 0.12
197 0.14
198 0.14
199 0.13
200 0.13
201 0.12
202 0.1
203 0.06
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.07
211 0.08
212 0.09
213 0.1
214 0.13
215 0.13
216 0.13
217 0.15
218 0.14
219 0.13
220 0.13
221 0.13
222 0.1
223 0.09
224 0.09
225 0.08
226 0.08
227 0.08
228 0.07
229 0.06
230 0.07
231 0.07
232 0.07
233 0.07
234 0.07
235 0.08
236 0.07
237 0.07
238 0.08
239 0.11
240 0.13
241 0.15
242 0.14
243 0.17
244 0.18
245 0.24
246 0.25
247 0.25
248 0.26
249 0.25
250 0.26
251 0.24
252 0.23
253 0.19
254 0.18
255 0.19
256 0.22
257 0.23
258 0.23
259 0.23
260 0.24
261 0.26
262 0.34
263 0.3
264 0.28
265 0.27
266 0.29
267 0.29
268 0.32
269 0.32
270 0.27
271 0.25
272 0.24
273 0.24
274 0.23
275 0.23
276 0.21
277 0.18
278 0.15
279 0.16
280 0.17
281 0.16
282 0.19
283 0.22
284 0.22
285 0.22
286 0.21
287 0.2
288 0.21
289 0.22
290 0.19
291 0.14
292 0.14
293 0.13
294 0.13
295 0.12
296 0.13
297 0.11
298 0.11
299 0.11
300 0.13
301 0.13
302 0.13
303 0.13
304 0.11
305 0.12
306 0.12
307 0.17
308 0.19
309 0.19
310 0.2
311 0.26
312 0.26
313 0.28
314 0.28
315 0.24
316 0.26
317 0.25
318 0.25
319 0.22
320 0.23
321 0.21
322 0.27
323 0.27
324 0.22
325 0.23
326 0.23
327 0.2
328 0.2
329 0.2
330 0.17
331 0.15
332 0.15
333 0.16
334 0.16
335 0.16
336 0.17
337 0.17
338 0.15
339 0.15
340 0.16
341 0.15
342 0.19
343 0.21
344 0.18
345 0.18
346 0.18
347 0.18
348 0.16
349 0.16
350 0.13
351 0.11
352 0.12
353 0.1
354 0.1
355 0.1
356 0.13
357 0.13
358 0.15
359 0.19
360 0.2
361 0.21
362 0.22
363 0.24
364 0.24
365 0.25
366 0.3
367 0.31
368 0.34
369 0.37
370 0.37
371 0.4
372 0.4
373 0.43
374 0.44
375 0.49
376 0.56
377 0.61
378 0.68
379 0.72
380 0.76
381 0.81
382 0.83
383 0.85
384 0.86
385 0.88
386 0.89
387 0.87
388 0.84
389 0.76
390 0.69
391 0.69
392 0.66
393 0.64
394 0.6
395 0.57
396 0.54
397 0.53
398 0.5
399 0.41
400 0.37
401 0.33
402 0.27
403 0.22
404 0.23
405 0.23
406 0.23