Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0IVG2

Protein Details
Accession A0A4T0IVG2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-113LLRQVFKFRTRRTRQNAAKPRFKQGSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5.5, cyto_nucl 13, nucl 19.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019465  Cog5  
Gene Ontology GO:0017119  C:Golgi transport complex  
GO:0016020  C:membrane  
GO:0006891  P:intra-Golgi vesicle-mediated transport  
Pfam View protein in Pfam  
PF10392  COG5  
Amino Acid Sequences MELSNKLSNLRKDIDSVENEIKDNVISNQNELFKYSESYSNINNYNISGTSQQLYDKISQLKSKISADYDELSNDIVDLTNVESALNLLRQVFKFRTRRTRQNAAKPRFKQGSRRFLNNVFDNLAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.38
4 0.38
5 0.35
6 0.34
7 0.32
8 0.28
9 0.21
10 0.2
11 0.17
12 0.18
13 0.17
14 0.19
15 0.23
16 0.25
17 0.25
18 0.25
19 0.24
20 0.18
21 0.21
22 0.2
23 0.21
24 0.21
25 0.22
26 0.23
27 0.25
28 0.26
29 0.25
30 0.23
31 0.18
32 0.17
33 0.15
34 0.15
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.12
42 0.11
43 0.13
44 0.16
45 0.17
46 0.18
47 0.19
48 0.2
49 0.21
50 0.21
51 0.19
52 0.17
53 0.16
54 0.16
55 0.17
56 0.15
57 0.13
58 0.12
59 0.11
60 0.09
61 0.08
62 0.06
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.09
77 0.1
78 0.15
79 0.18
80 0.26
81 0.35
82 0.42
83 0.53
84 0.58
85 0.68
86 0.72
87 0.8
88 0.81
89 0.84
90 0.86
91 0.84
92 0.86
93 0.79
94 0.8
95 0.78
96 0.73
97 0.73
98 0.72
99 0.74
100 0.7
101 0.74
102 0.71
103 0.68
104 0.73
105 0.66
106 0.6