Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0L916

Protein Details
Accession A0A4T0L916    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSIYAQGKRRYDRKQSGFGGQTKPIFHKKAKTTKKVVLRLECSACKYKMQLSLKRTKHFELKIFTRTLPLTNSYRKQKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.9
7 0.9
8 0.89
9 0.88
10 0.89
11 0.9
12 0.85
13 0.87
14 0.86
15 0.82
16 0.76
17 0.72
18 0.62
19 0.57
20 0.55
21 0.54
22 0.54
23 0.54
24 0.55
25 0.56
26 0.59
27 0.59
28 0.62
29 0.59
30 0.59
31 0.62
32 0.62
33 0.63
34 0.62
35 0.62
36 0.6
37 0.57
38 0.5
39 0.43
40 0.39
41 0.32
42 0.33
43 0.32
44 0.31
45 0.28
46 0.32
47 0.37
48 0.46
49 0.54
50 0.58
51 0.59
52 0.62
53 0.69
54 0.7
55 0.68
56 0.64
57 0.59
58 0.56
59 0.54
60 0.49
61 0.44
62 0.41
63 0.35
64 0.3
65 0.28
66 0.27
67 0.32
68 0.38
69 0.42
70 0.44
71 0.54
72 0.59
73 0.64
74 0.64
75 0.59
76 0.6
77 0.58
78 0.57
79 0.55
80 0.54
81 0.54
82 0.52
83 0.48
84 0.44
85 0.39
86 0.35
87 0.3
88 0.29
89 0.3
90 0.37
91 0.45
92 0.5
93 0.54
94 0.54
95 0.54
96 0.53