Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0J313

Protein Details
Accession A0A4T0J313    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-80ARIRSRTGRKIISRRLKKGKKNMSHBasic
NLS Segment(s)
PositionSequence
46-78RKRKRTFGFLARIRSRTGRKIISRRLKKGKKNM
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRKIPLFPTFTTLLNRRPTLPAISAIAANGLRFGSRGTDYQPSTRKRKRTFGFLARIRSRTGRKIISRRLKKGKKNMSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.39
4 0.36
5 0.37
6 0.37
7 0.34
8 0.32
9 0.27
10 0.23
11 0.22
12 0.2
13 0.17
14 0.16
15 0.12
16 0.1
17 0.09
18 0.07
19 0.06
20 0.06
21 0.06
22 0.07
23 0.08
24 0.09
25 0.11
26 0.16
27 0.17
28 0.22
29 0.29
30 0.33
31 0.42
32 0.47
33 0.54
34 0.55
35 0.64
36 0.62
37 0.65
38 0.69
39 0.68
40 0.71
41 0.67
42 0.71
43 0.66
44 0.64
45 0.57
46 0.55
47 0.52
48 0.49
49 0.5
50 0.49
51 0.54
52 0.62
53 0.7
54 0.74
55 0.79
56 0.82
57 0.86
58 0.88
59 0.88
60 0.9