Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0JY36

Protein Details
Accession A0A4T0JY36   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-31DKKAPETKKSKAKEPVKPLDPBasic
NLS Segment(s)
PositionSequence
4-24KRKADGDDKKAPETKKSKAKE
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
PROSITE View protein in PROSITE  
PS51435  AP_NUCLEASE_F1_4  
CDD cd09087  Ape1-like_AP-endo  
Amino Acid Sequences MPPKRKADGDDKKAPETKKSKAKEPVKPLDPTQPVNKQLPEELGAYEKGEGVTRMTCWNIAGYNASVKKVGKNICYVCRLLRDAQGMHRYINAEPADLLVLTETKIDKEPNDEILKSNYKHSVWAGSTKKGYAGIAVLWNGEEARNVETILPTHPNQDSTRGRIITLEFEDKFVIGTYVPNAGQGLKAMDDKVAWNSAFKTYLHDLNEKKSVVWLGDLNVCHDSKDIRNDKSNWNKSAGWTETEVNGYKEQLSDKFVDAWKELHPDNVGQYTYFGYRFDARSKGIGWRIDSCVVSRGLMGRVEDVVIRMEVYGASDHVPVCIDFKAVDEQASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.62
4 0.62
5 0.62
6 0.63
7 0.65
8 0.7
9 0.77
10 0.77
11 0.81
12 0.82
13 0.78
14 0.77
15 0.71
16 0.71
17 0.66
18 0.61
19 0.59
20 0.57
21 0.55
22 0.56
23 0.55
24 0.48
25 0.45
26 0.43
27 0.37
28 0.3
29 0.26
30 0.23
31 0.21
32 0.19
33 0.17
34 0.15
35 0.13
36 0.12
37 0.12
38 0.11
39 0.12
40 0.12
41 0.15
42 0.15
43 0.15
44 0.14
45 0.15
46 0.14
47 0.14
48 0.14
49 0.13
50 0.2
51 0.21
52 0.21
53 0.22
54 0.22
55 0.25
56 0.29
57 0.33
58 0.29
59 0.36
60 0.4
61 0.43
62 0.46
63 0.45
64 0.4
65 0.4
66 0.4
67 0.35
68 0.34
69 0.32
70 0.3
71 0.35
72 0.39
73 0.35
74 0.32
75 0.32
76 0.29
77 0.25
78 0.3
79 0.23
80 0.17
81 0.16
82 0.16
83 0.14
84 0.12
85 0.12
86 0.06
87 0.06
88 0.05
89 0.07
90 0.07
91 0.08
92 0.09
93 0.11
94 0.11
95 0.15
96 0.17
97 0.21
98 0.24
99 0.24
100 0.24
101 0.28
102 0.33
103 0.3
104 0.31
105 0.29
106 0.26
107 0.27
108 0.27
109 0.26
110 0.22
111 0.3
112 0.3
113 0.29
114 0.3
115 0.28
116 0.28
117 0.24
118 0.22
119 0.14
120 0.12
121 0.09
122 0.09
123 0.09
124 0.08
125 0.07
126 0.08
127 0.07
128 0.06
129 0.06
130 0.05
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.1
138 0.12
139 0.11
140 0.13
141 0.13
142 0.16
143 0.16
144 0.24
145 0.24
146 0.25
147 0.29
148 0.27
149 0.26
150 0.25
151 0.25
152 0.19
153 0.19
154 0.19
155 0.15
156 0.15
157 0.15
158 0.14
159 0.13
160 0.1
161 0.08
162 0.05
163 0.05
164 0.05
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.11
181 0.09
182 0.1
183 0.11
184 0.12
185 0.13
186 0.13
187 0.16
188 0.16
189 0.2
190 0.22
191 0.27
192 0.27
193 0.29
194 0.34
195 0.3
196 0.27
197 0.24
198 0.23
199 0.17
200 0.17
201 0.14
202 0.11
203 0.15
204 0.15
205 0.15
206 0.17
207 0.16
208 0.15
209 0.15
210 0.15
211 0.15
212 0.25
213 0.29
214 0.31
215 0.37
216 0.41
217 0.5
218 0.59
219 0.63
220 0.56
221 0.54
222 0.51
223 0.47
224 0.51
225 0.43
226 0.34
227 0.29
228 0.28
229 0.24
230 0.26
231 0.25
232 0.2
233 0.19
234 0.17
235 0.15
236 0.15
237 0.16
238 0.15
239 0.17
240 0.17
241 0.18
242 0.21
243 0.23
244 0.24
245 0.23
246 0.23
247 0.22
248 0.24
249 0.23
250 0.22
251 0.21
252 0.2
253 0.21
254 0.23
255 0.21
256 0.17
257 0.18
258 0.17
259 0.18
260 0.17
261 0.14
262 0.14
263 0.18
264 0.21
265 0.24
266 0.26
267 0.25
268 0.27
269 0.29
270 0.33
271 0.35
272 0.36
273 0.36
274 0.36
275 0.38
276 0.39
277 0.38
278 0.32
279 0.3
280 0.27
281 0.24
282 0.2
283 0.19
284 0.18
285 0.19
286 0.19
287 0.16
288 0.16
289 0.16
290 0.16
291 0.14
292 0.13
293 0.11
294 0.1
295 0.09
296 0.09
297 0.08
298 0.09
299 0.09
300 0.08
301 0.1
302 0.11
303 0.11
304 0.11
305 0.13
306 0.12
307 0.13
308 0.12
309 0.12
310 0.1
311 0.13
312 0.18
313 0.18