Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0KAJ1

Protein Details
Accession A0A4T0KAJ1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-23KSMRSNVKKAHRSAKRSREDSHydrophilic
79-99STHGRDVGRHRKRQQARSGASHydrophilic
NLS Segment(s)
PositionSequence
86-110GRHRKRQQARSGASFNGRKGGNRKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSMRSNVKKAHRSAKRSREDSDYHIKDQARLARLNSRLTSTQPSDEAIKDNRPEFAEDLGAGEMPINTDSNTDKKVSTHGRDVGRHRKRQQARSGASFNGRKGGNRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.81
4 0.81
5 0.77
6 0.73
7 0.7
8 0.64
9 0.62
10 0.62
11 0.56
12 0.48
13 0.49
14 0.46
15 0.41
16 0.42
17 0.41
18 0.34
19 0.31
20 0.32
21 0.34
22 0.36
23 0.38
24 0.34
25 0.31
26 0.29
27 0.29
28 0.32
29 0.27
30 0.25
31 0.21
32 0.22
33 0.2
34 0.2
35 0.2
36 0.17
37 0.19
38 0.19
39 0.19
40 0.2
41 0.18
42 0.19
43 0.17
44 0.15
45 0.12
46 0.1
47 0.1
48 0.09
49 0.08
50 0.06
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.08
59 0.11
60 0.13
61 0.13
62 0.13
63 0.14
64 0.21
65 0.27
66 0.3
67 0.34
68 0.39
69 0.43
70 0.49
71 0.57
72 0.61
73 0.63
74 0.68
75 0.68
76 0.72
77 0.75
78 0.79
79 0.81
80 0.8
81 0.77
82 0.76
83 0.74
84 0.68
85 0.67
86 0.62
87 0.53
88 0.48
89 0.43
90 0.41