FuNGI

A0A4T0G4K0

Protein Details

Accession

A0A4T0G4K0

Localization Confidence

Medium

Confidence Score

10.5

NoLS Segment(s)

Position	Sequence	Protein Nature
623-662	ITKLMNGYKKRAEKQQKQALKEVKISEKKRRHSVQVGPLV	Hydrophilic

NLS Segment(s)

Position	Sequence
632-653	KRAEKQQKQALKEVKISEKKRR

Subcellular Location(s)

cyto 13, cyto_nucl 12.5, nucl 10, mito 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR006935 Helicase/UvrB_N IPR014001 Helicase_ATP-bd IPR001650 Helicase_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0005524 F:ATP binding GO:0003677 F:DNA binding GO:0004386 F:helicase activity GO:0016787 F:hydrolase activity
Pfam	View protein in Pfam PF00271 Helicase_C PF04851 ResIII
PROSITE	View protein in PROSITE PS51192 HELICASE_ATP_BIND_1 PS51194 HELICASE_CTER
CDD	cd18799 SF2_C_EcoAI-like

Amino Acid Sequences

MLETAYFNTPNIPFEMRYPQALRMALKLSLPCKIHTRSLSASVIPEKFTLRPYQEAAIASVMDALNRPKHPKSRLGVSSPTGSGKTRMFVELARRLSESKPGKVLVIVNGIELASQAYDAFVSGWPSASVEMDQSASVATGDADVTIATFQTLIRPGRMSKYDPADFKLLLVDEAHHAAARSYVDILAHFDPSIHGEQDSVTGSKVPIVGFSATFSRHDSLALGKVFEEIVFHKDFLDMIKERWLSNVTFTTVKTDIDLSQVKISERTNDYTVTSLSPILNTPSVRRVVLAAYLDKCSDRRSTLIFCADLKHVHNLTADFRDAGIDARFIHSGTPPKERVKILRDFKEYRYPVLLNCAVLTEGADIPNIDCILLCRPTRSRNLFSQMIGRGMRVAQGKTECKILDVAASLDKVGDISAAPSLEGLDMTEFDRVDSKAVEGDVKNDLSEHPLFKEENEQNIVPHADYITFTDFDDPRALFESLKNKHSDNVYNQSQNAWVDCRGGFYVLSCQQAGDLRIEHTGEGKYTASHKPTNVPLQDAKRVGLAPFRRPITLVHDVDFKLAIRASDKLATEKLMRGKAALIRRDAPWRRAPATKSQLDALTKRLKGGFNTDLLKGEAADMITKLMNGYKKRAEKQQKQALKEVKISEKKRRHSVQVGPLV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.34
3	0.31
4	0.36
5	0.37
6	0.38
7	0.4
8	0.43
9	0.4
10	0.35
11	0.36
12	0.31
13	0.32
14	0.33
15	0.29
16	0.32
17	0.33
18	0.32
19	0.36
20	0.39
21	0.43
22	0.42
23	0.46
24	0.44
25	0.49
26	0.49
27	0.43
28	0.43
29	0.42
30	0.4
31	0.35
32	0.32
33	0.28
34	0.27
35	0.29
36	0.32
37	0.29
38	0.32
39	0.34
40	0.35
41	0.36
42	0.35
43	0.33
44	0.27
45	0.22
46	0.18
47	0.18
48	0.15
49	0.12
50	0.12
51	0.15
52	0.2
53	0.24
54	0.3
55	0.35
56	0.43
57	0.49
58	0.56
59	0.59
60	0.63
61	0.66
62	0.66
63	0.65
64	0.6
65	0.58
66	0.51
67	0.47
68	0.39
69	0.33
70	0.31
71	0.26
72	0.26
73	0.23
74	0.23
75	0.22
76	0.23
77	0.3
78	0.34
79	0.35
80	0.34
81	0.34
82	0.34
83	0.34
84	0.41
85	0.38
86	0.34
87	0.36
88	0.35
89	0.34
90	0.34
91	0.36
92	0.3
93	0.29
94	0.25
95	0.21
96	0.2
97	0.19
98	0.16
99	0.14
100	0.1
101	0.05
102	0.05
103	0.04
104	0.04
105	0.04
106	0.05
107	0.05
108	0.06
109	0.08
110	0.08
111	0.09
112	0.09
113	0.1
114	0.1
115	0.1
116	0.1
117	0.08
118	0.09
119	0.09
120	0.08
121	0.08
122	0.07
123	0.07
124	0.06
125	0.06
126	0.05
127	0.04
128	0.05
129	0.04
130	0.04
131	0.04
132	0.04
133	0.04
134	0.04
135	0.04
136	0.04
137	0.04
138	0.07
139	0.13
140	0.14
141	0.15
142	0.18
143	0.19
144	0.25
145	0.29
146	0.3
147	0.31
148	0.38
149	0.41
150	0.41
151	0.42
152	0.4
153	0.36
154	0.32
155	0.28
156	0.21
157	0.16
158	0.14
159	0.12
160	0.1
161	0.12
162	0.11
163	0.09
164	0.09
165	0.09
166	0.1
167	0.1
168	0.09
169	0.08
170	0.08
171	0.08
172	0.09
173	0.12
174	0.11
175	0.12
176	0.11
177	0.1
178	0.1
179	0.13
180	0.15
181	0.11
182	0.1
183	0.1
184	0.1
185	0.12
186	0.13
187	0.1
188	0.09
189	0.09
190	0.09
191	0.1
192	0.12
193	0.1
194	0.09
195	0.1
196	0.11
197	0.1
198	0.11
199	0.12
200	0.11
201	0.12
202	0.14
203	0.14
204	0.13
205	0.13
206	0.13
207	0.13
208	0.17
209	0.17
210	0.14
211	0.13
212	0.13
213	0.13
214	0.12
215	0.11
216	0.07
217	0.11
218	0.11
219	0.11
220	0.11
221	0.11
222	0.12
223	0.11
224	0.16
225	0.13
226	0.13
227	0.19
228	0.2
229	0.2
230	0.21
231	0.22
232	0.17
233	0.19
234	0.2
235	0.16
236	0.16
237	0.16
238	0.19
239	0.18
240	0.18
241	0.15
242	0.15
243	0.13
244	0.16
245	0.18
246	0.15
247	0.16
248	0.17
249	0.17
250	0.18
251	0.18
252	0.19
253	0.2
254	0.22
255	0.21
256	0.21
257	0.21
258	0.19
259	0.2
260	0.15
261	0.13
262	0.11
263	0.1
264	0.09
265	0.09
266	0.1
267	0.11
268	0.11
269	0.12
270	0.15
271	0.16
272	0.16
273	0.15
274	0.14
275	0.13
276	0.15
277	0.15
278	0.13
279	0.13
280	0.14
281	0.14
282	0.14
283	0.14
284	0.14
285	0.14
286	0.13
287	0.13
288	0.16
289	0.18
290	0.21
291	0.23
292	0.21
293	0.2
294	0.21
295	0.2
296	0.19
297	0.17
298	0.19
299	0.16
300	0.17
301	0.17
302	0.16
303	0.17
304	0.17
305	0.16
306	0.11
307	0.11
308	0.1
309	0.09
310	0.09
311	0.07
312	0.06
313	0.06
314	0.08
315	0.08
316	0.08
317	0.08
318	0.09
319	0.15
320	0.17
321	0.22
322	0.24
323	0.27
324	0.31
325	0.32
326	0.35
327	0.35
328	0.41
329	0.43
330	0.47
331	0.51
332	0.5
333	0.52
334	0.56
335	0.51
336	0.43
337	0.4
338	0.33
339	0.27
340	0.29
341	0.27
342	0.17
343	0.17
344	0.15
345	0.12
346	0.11
347	0.11
348	0.06
349	0.06
350	0.06
351	0.06
352	0.05
353	0.05
354	0.06
355	0.06
356	0.04
357	0.04
358	0.05
359	0.08
360	0.12
361	0.12
362	0.14
363	0.17
364	0.22
365	0.3
366	0.36
367	0.37
368	0.38
369	0.44
370	0.44
371	0.42
372	0.42
373	0.35
374	0.33
375	0.29
376	0.24
377	0.18
378	0.16
379	0.19
380	0.16
381	0.15
382	0.14
383	0.19
384	0.21
385	0.21
386	0.24
387	0.2
388	0.18
389	0.19
390	0.16
391	0.12
392	0.11
393	0.11
394	0.09
395	0.09
396	0.08
397	0.07
398	0.07
399	0.06
400	0.05
401	0.04
402	0.03
403	0.04
404	0.05
405	0.05
406	0.05
407	0.05
408	0.05
409	0.05
410	0.05
411	0.04
412	0.04
413	0.05
414	0.05
415	0.07
416	0.07
417	0.07
418	0.09
419	0.09
420	0.1
421	0.1
422	0.09
423	0.09
424	0.1
425	0.13
426	0.11
427	0.13
428	0.15
429	0.15
430	0.14
431	0.13
432	0.13
433	0.14
434	0.16
435	0.15
436	0.13
437	0.16
438	0.16
439	0.16
440	0.26
441	0.23
442	0.26
443	0.29
444	0.28
445	0.25
446	0.28
447	0.28
448	0.18
449	0.16
450	0.12
451	0.09
452	0.09
453	0.11
454	0.11
455	0.11
456	0.11
457	0.16
458	0.16
459	0.17
460	0.19
461	0.17
462	0.16
463	0.19
464	0.19
465	0.15
466	0.19
467	0.27
468	0.28
469	0.32
470	0.33
471	0.3
472	0.33
473	0.37
474	0.39
475	0.37
476	0.42
477	0.43
478	0.44
479	0.44
480	0.41
481	0.39
482	0.33
483	0.28
484	0.22
485	0.17
486	0.16
487	0.16
488	0.17
489	0.15
490	0.15
491	0.13
492	0.12
493	0.18
494	0.19
495	0.21
496	0.19
497	0.18
498	0.19
499	0.21
500	0.22
501	0.17
502	0.15
503	0.14
504	0.16
505	0.16
506	0.15
507	0.15
508	0.14
509	0.13
510	0.13
511	0.12
512	0.12
513	0.16
514	0.22
515	0.24
516	0.27
517	0.28
518	0.32
519	0.38
520	0.45
521	0.43
522	0.42
523	0.44
524	0.46
525	0.52
526	0.48
527	0.42
528	0.35
529	0.35
530	0.31
531	0.32
532	0.31
533	0.31
534	0.36
535	0.38
536	0.36
537	0.36
538	0.37
539	0.37
540	0.42
541	0.36
542	0.31
543	0.35
544	0.34
545	0.34
546	0.33
547	0.25
548	0.18
549	0.17
550	0.16
551	0.13
552	0.15
553	0.17
554	0.2
555	0.21
556	0.22
557	0.23
558	0.25
559	0.25
560	0.29
561	0.33
562	0.32
563	0.32
564	0.29
565	0.32
566	0.35
567	0.4
568	0.4
569	0.38
570	0.37
571	0.4
572	0.5
573	0.52
574	0.53
575	0.53
576	0.55
577	0.55
578	0.59
579	0.59
580	0.6
581	0.63
582	0.6
583	0.54
584	0.5
585	0.51
586	0.5
587	0.48
588	0.45
589	0.44
590	0.41
591	0.42
592	0.43
593	0.4
594	0.37
595	0.43
596	0.4
597	0.37
598	0.39
599	0.37
600	0.35
601	0.33
602	0.31
603	0.23
604	0.19
605	0.15
606	0.13
607	0.13
608	0.11
609	0.11
610	0.11
611	0.11
612	0.11
613	0.14
614	0.2
615	0.22
616	0.3
617	0.37
618	0.46
619	0.52
620	0.62
621	0.69
622	0.73
623	0.8
624	0.84
625	0.83
626	0.79
627	0.83
628	0.8
629	0.75
630	0.72
631	0.68
632	0.68
633	0.7
634	0.72
635	0.73
636	0.74
637	0.77
638	0.81
639	0.81
640	0.8
641	0.79
642	0.81

A0A4T0G4K0

3D AlphaFold-predicted Structure Viewer