FuNGI

A0A4T0J4Z5

Protein Details

Accession

A0A4T0J4Z5

Localization Confidence

Medium

Confidence Score

10.9

NoLS Segment(s)

Position	Sequence	Protein Nature
38-70	PLKASKPAAKPAKPTKSKRRRQQLQYSVKKCAM	Hydrophilic

NLS Segment(s)

Position	Sequence
41-58	ASKPAAKPAKPTKSKRRR

Subcellular Location(s)

nucl 10.5, cyto_nucl 10, cyto 8.5, pero 4, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR024051 AICAR_Tfase_dup_dom_sf IPR024050 AICAR_Tfase_insert_dom_sf IPR016193 Cytidine_deaminase-like IPR011607 MGS-like_dom IPR036914 MGS-like_dom_sf IPR002695 PurH-like IPR023534 Rof/RNase_P-like IPR002730 Rpp29/RNP1
Gene Ontology	GO:0005829 C:cytosol GO:0030677 C:ribonuclease P complex GO:0003937 F:IMP cyclohydrolase activity GO:0004643 F:phosphoribosylaminoimidazolecarboxamide formyltransferase activity GO:0003723 F:RNA binding GO:0006189 P:'de novo' IMP biosynthetic process GO:0001682 P:tRNA 5'-leader removal
Pfam	View protein in Pfam PF01808 AICARFT_IMPCHas PF02142 MGS PF01868 RNase_P-MRP_p29
PROSITE	View protein in PROSITE PS51855 MGS
CDD	cd01421 IMPCH

Amino Acid Sequences

MSFAEKLLRSRLNEDNEEKAKKVYSSKLEDSTVMLDNPLKASKPAAKPAKPTKSKRRRQQLQYSVKKCAMSYETAVKMNKLWNEYIKDIIAGDINSIQSKMLKADLCGCRLIVHSSNNASLVGKEGICILETENSFAIITPDSTHKSIPKNGSLGFNLLGSGGTSKKIRDAGIPISDVQDITNAPEMLGGRVKTLHPAVHGGILATNSASDNADLEKQAYTKIDLVICNLYPFKETVAKPDVSLPNAVEEIDIGGVTLLRAAAKNHERVSILSDPTDYKSFVESYKNGVDQSLRNKWALKAFSHTADYDNAISNYFRQQYASLDTSNDLVQRFPLRYGANPHQKPAQAYVTQGEMPIKVLSGSPGYINLLDGLNSWGLVKELAEALSLPAAASFKHVSPAGAAVGVPLNDVEKKVFMVDDLKQMSPLATAYARARGADRMSSFGDFIALSHEVDYATARIINREVSDGVIAPAYSQEALEILQKKKGGKYCMLQIDPAFTPSDIETRSVYGITLEQRRNDAKITNETFANVVSNEKALSKQALIDLTVATIAVKYTQSNSVGYAVNGAVVGLGAGQQSRIHCTRLAGDKADNWWLRHHPRVLALPWKKSVKRAEKANAIDLFVTGEAWKATGSERAQWESMFEEVPAPLSEEEVKSHAKEFAQLGVACCSDAFFPFPDNVHRAHRSGVKYVAASIGSVMDEEVIKAANEYGIVYSALPLRLFHH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.54
2	0.56
3	0.58
4	0.59
5	0.54
6	0.49
7	0.45
8	0.41
9	0.44
10	0.43
11	0.44
12	0.49
13	0.54
14	0.56
15	0.55
16	0.52
17	0.47
18	0.42
19	0.36
20	0.28
21	0.23
22	0.2
23	0.19
24	0.21
25	0.21
26	0.19
27	0.17
28	0.23
29	0.3
30	0.34
31	0.43
32	0.51
33	0.54
34	0.62
35	0.72
36	0.78
37	0.79
38	0.83
39	0.84
40	0.85
41	0.9
42	0.92
43	0.92
44	0.92
45	0.92
46	0.93
47	0.93
48	0.93
49	0.93
50	0.88
51	0.84
52	0.77
53	0.68
54	0.57
55	0.52
56	0.45
57	0.38
58	0.37
59	0.38
60	0.38
61	0.41
62	0.42
63	0.37
64	0.36
65	0.37
66	0.37
67	0.32
68	0.32
69	0.34
70	0.38
71	0.39
72	0.39
73	0.34
74	0.3
75	0.27
76	0.24
77	0.19
78	0.14
79	0.13
80	0.12
81	0.12
82	0.13
83	0.13
84	0.12
85	0.12
86	0.13
87	0.13
88	0.16
89	0.16
90	0.17
91	0.26
92	0.3
93	0.31
94	0.31
95	0.29
96	0.26
97	0.26
98	0.3
99	0.25
100	0.24
101	0.26
102	0.28
103	0.29
104	0.29
105	0.28
106	0.23
107	0.18
108	0.19
109	0.16
110	0.13
111	0.12
112	0.12
113	0.12
114	0.12
115	0.12
116	0.1
117	0.13
118	0.13
119	0.15
120	0.14
121	0.14
122	0.14
123	0.14
124	0.14
125	0.09
126	0.09
127	0.09
128	0.13
129	0.16
130	0.18
131	0.2
132	0.24
133	0.29
134	0.35
135	0.39
136	0.4
137	0.41
138	0.42
139	0.44
140	0.4
141	0.37
142	0.3
143	0.24
144	0.19
145	0.15
146	0.13
147	0.09
148	0.09
149	0.08
150	0.1
151	0.11
152	0.11
153	0.15
154	0.17
155	0.18
156	0.2
157	0.24
158	0.27
159	0.29
160	0.3
161	0.27
162	0.26
163	0.25
164	0.22
165	0.17
166	0.13
167	0.1
168	0.1
169	0.14
170	0.12
171	0.12
172	0.14
173	0.14
174	0.14
175	0.18
176	0.16
177	0.12
178	0.14
179	0.14
180	0.16
181	0.18
182	0.17
183	0.15
184	0.18
185	0.18
186	0.18
187	0.18
188	0.14
189	0.13
190	0.12
191	0.11
192	0.08
193	0.07
194	0.06
195	0.06
196	0.06
197	0.05
198	0.06
199	0.07
200	0.09
201	0.08
202	0.09
203	0.1
204	0.1
205	0.11
206	0.11
207	0.12
208	0.12
209	0.15
210	0.16
211	0.15
212	0.17
213	0.18
214	0.17
215	0.17
216	0.16
217	0.14
218	0.12
219	0.12
220	0.13
221	0.18
222	0.18
223	0.22
224	0.27
225	0.27
226	0.27
227	0.34
228	0.34
229	0.28
230	0.29
231	0.23
232	0.19
233	0.19
234	0.19
235	0.11
236	0.08
237	0.07
238	0.06
239	0.06
240	0.04
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.04
248	0.05
249	0.12
250	0.16
251	0.21
252	0.22
253	0.24
254	0.24
255	0.24
256	0.29
257	0.27
258	0.24
259	0.2
260	0.2
261	0.19
262	0.2
263	0.21
264	0.16
265	0.12
266	0.13
267	0.14
268	0.14
269	0.18
270	0.16
271	0.19
272	0.21
273	0.22
274	0.2
275	0.2
276	0.2
277	0.19
278	0.26
279	0.28
280	0.27
281	0.27
282	0.29
283	0.3
284	0.33
285	0.32
286	0.26
287	0.25
288	0.25
289	0.26
290	0.26
291	0.25
292	0.21
293	0.19
294	0.19
295	0.15
296	0.14
297	0.12
298	0.11
299	0.11
300	0.1
301	0.13
302	0.13
303	0.12
304	0.12
305	0.12
306	0.14
307	0.18
308	0.19
309	0.15
310	0.15
311	0.15
312	0.15
313	0.15
314	0.15
315	0.1
316	0.09
317	0.09
318	0.11
319	0.11
320	0.11
321	0.14
322	0.13
323	0.15
324	0.22
325	0.29
326	0.37
327	0.37
328	0.38
329	0.38
330	0.39
331	0.38
332	0.35
333	0.31
334	0.22
335	0.22
336	0.21
337	0.19
338	0.18
339	0.17
340	0.14
341	0.09
342	0.09
343	0.08
344	0.07
345	0.06
346	0.06
347	0.06
348	0.06
349	0.06
350	0.05
351	0.06
352	0.06
353	0.06
354	0.06
355	0.06
356	0.05
357	0.05
358	0.05
359	0.06
360	0.05
361	0.05
362	0.05
363	0.05
364	0.05
365	0.05
366	0.04
367	0.04
368	0.04
369	0.04
370	0.04
371	0.04
372	0.04
373	0.04
374	0.04
375	0.04
376	0.04
377	0.04
378	0.04
379	0.06
380	0.07
381	0.07
382	0.09
383	0.1
384	0.09
385	0.09
386	0.1
387	0.08
388	0.07
389	0.07
390	0.05
391	0.06
392	0.06
393	0.05
394	0.04
395	0.05
396	0.05
397	0.06
398	0.06
399	0.06
400	0.06
401	0.06
402	0.06
403	0.06
404	0.09
405	0.1
406	0.15
407	0.17
408	0.17
409	0.17
410	0.17
411	0.17
412	0.14
413	0.12
414	0.08
415	0.06
416	0.08
417	0.09
418	0.12
419	0.12
420	0.12
421	0.13
422	0.14
423	0.15
424	0.17
425	0.17
426	0.16
427	0.17
428	0.17
429	0.16
430	0.14
431	0.13
432	0.09
433	0.09
434	0.09
435	0.08
436	0.08
437	0.08
438	0.08
439	0.08
440	0.08
441	0.09
442	0.06
443	0.06
444	0.07
445	0.07
446	0.08
447	0.09
448	0.1
449	0.1
450	0.11
451	0.11
452	0.1
453	0.1
454	0.1
455	0.09
456	0.08
457	0.07
458	0.06
459	0.06
460	0.06
461	0.05
462	0.05
463	0.04
464	0.04
465	0.05
466	0.1
467	0.15
468	0.16
469	0.19
470	0.22
471	0.23
472	0.28
473	0.33
474	0.33
475	0.32
476	0.35
477	0.4
478	0.45
479	0.44
480	0.41
481	0.36
482	0.35
483	0.31
484	0.28
485	0.21
486	0.13
487	0.14
488	0.12
489	0.15
490	0.12
491	0.13
492	0.13
493	0.13
494	0.14
495	0.13
496	0.12
497	0.09
498	0.11
499	0.15
500	0.22
501	0.23
502	0.24
503	0.28
504	0.3
505	0.31
506	0.31
507	0.29
508	0.26
509	0.33
510	0.35
511	0.33
512	0.31
513	0.3
514	0.28
515	0.25
516	0.22
517	0.13
518	0.1
519	0.09
520	0.09
521	0.09
522	0.1
523	0.1
524	0.1
525	0.12
526	0.11
527	0.12
528	0.14
529	0.14
530	0.14
531	0.14
532	0.12
533	0.1
534	0.1
535	0.08
536	0.06
537	0.05
538	0.05
539	0.05
540	0.06
541	0.07
542	0.09
543	0.13
544	0.15
545	0.15
546	0.16
547	0.18
548	0.18
549	0.17
550	0.17
551	0.13
552	0.11
553	0.11
554	0.09
555	0.06
556	0.05
557	0.05
558	0.03
559	0.03
560	0.03
561	0.04
562	0.05
563	0.07
564	0.08
565	0.14
566	0.16
567	0.17
568	0.18
569	0.2
570	0.26
571	0.32
572	0.35
573	0.32
574	0.32
575	0.33
576	0.35
577	0.42
578	0.39
579	0.32
580	0.33
581	0.39
582	0.43
583	0.47
584	0.48
585	0.42
586	0.44
587	0.49
588	0.48
589	0.51
590	0.51
591	0.49
592	0.52
593	0.58
594	0.55
595	0.57
596	0.63
597	0.63
598	0.64
599	0.68
600	0.7
601	0.7
602	0.72
603	0.72
604	0.63
605	0.54
606	0.46
607	0.37
608	0.3
609	0.21
610	0.17
611	0.1
612	0.09
613	0.07
614	0.07
615	0.07
616	0.07
617	0.08
618	0.14
619	0.16
620	0.21
621	0.25
622	0.29
623	0.3
624	0.29
625	0.29
626	0.25
627	0.25
628	0.19
629	0.15
630	0.13
631	0.11
632	0.13
633	0.12
634	0.13
635	0.11
636	0.13
637	0.15
638	0.15
639	0.17
640	0.18
641	0.21
642	0.19
643	0.21
644	0.23
645	0.21
646	0.24
647	0.24
648	0.24
649	0.28
650	0.28
651	0.28
652	0.27
653	0.27
654	0.22
655	0.21
656	0.18
657	0.12
658	0.12
659	0.13
660	0.1
661	0.12
662	0.15
663	0.17
664	0.22
665	0.24
666	0.26
667	0.32
668	0.35
669	0.35
670	0.38
671	0.44
672	0.42
673	0.45
674	0.46
675	0.42
676	0.38
677	0.38
678	0.35
679	0.28
680	0.24
681	0.19
682	0.15
683	0.12
684	0.11
685	0.1
686	0.07
687	0.07
688	0.07
689	0.08
690	0.07
691	0.07
692	0.08
693	0.08
694	0.08
695	0.08
696	0.08
697	0.08
698	0.09
699	0.1
700	0.09
701	0.11
702	0.14
703	0.16
704	0.15

A0A4T0J4Z5

3D AlphaFold-predicted Structure Viewer