Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0IWD0

Protein Details
Accession A0A4T0IWD0    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKLRWTKAFRKAAGKEBasic
NLS Segment(s)
PositionSequence
6-13RKLRWTKA
15-15R
54-83RVGEIRKRREVAFWKNRMAANSQRRKLADK
Subcellular Location(s) nucl 15, mito_nucl 13.5, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLRWTKAFRKAAGKEMTIDSTLEFEKRRHVPVRYNRTLVATTLKAMKRVGEIRKRREVAFWKNRMAANSQRRKLADKKEVSKSINLLPGIKASTKAAASAQTAKQKVKVPKNKSSNLASAGGSGQKMTMDMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.76
4 0.74
5 0.69
6 0.6
7 0.52
8 0.46
9 0.42
10 0.33
11 0.3
12 0.21
13 0.18
14 0.17
15 0.16
16 0.15
17 0.14
18 0.2
19 0.24
20 0.3
21 0.34
22 0.37
23 0.45
24 0.54
25 0.64
26 0.62
27 0.61
28 0.56
29 0.53
30 0.49
31 0.4
32 0.34
33 0.24
34 0.19
35 0.24
36 0.23
37 0.22
38 0.22
39 0.21
40 0.21
41 0.27
42 0.34
43 0.37
44 0.44
45 0.49
46 0.58
47 0.59
48 0.55
49 0.55
50 0.55
51 0.56
52 0.57
53 0.55
54 0.49
55 0.51
56 0.51
57 0.46
58 0.42
59 0.4
60 0.4
61 0.45
62 0.44
63 0.44
64 0.44
65 0.48
66 0.52
67 0.52
68 0.51
69 0.5
70 0.54
71 0.58
72 0.63
73 0.6
74 0.55
75 0.48
76 0.42
77 0.4
78 0.34
79 0.27
80 0.21
81 0.21
82 0.21
83 0.19
84 0.16
85 0.12
86 0.14
87 0.13
88 0.14
89 0.13
90 0.14
91 0.16
92 0.2
93 0.24
94 0.29
95 0.32
96 0.32
97 0.37
98 0.42
99 0.49
100 0.55
101 0.6
102 0.61
103 0.68
104 0.76
105 0.77
106 0.76
107 0.72
108 0.66
109 0.6
110 0.55
111 0.44
112 0.36
113 0.32
114 0.28
115 0.23
116 0.17
117 0.14
118 0.11