Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0F799

Protein Details
Accession A0A4T0F799   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-113PLDMRHKKTRAIRRQLTPKEKSAKTTRQHKRDVHFBasic
NLS Segment(s)
PositionSequence
75-122GKRIPLDMRHKKTRAIRRQLTPKEKSAKTTRQHKRDVHFGRRKFAVKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVQVKAHELQNKNKTDLLNQLHELKGELVQLRVAKVAGGSASKLTKIHSVRKSVARVLTVINQKQRQHVAEAYKGKRIPLDMRHKKTRAIRRQLTPKEKSAKTTRQHKRDVHFGRRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.48
4 0.44
5 0.4
6 0.38
7 0.39
8 0.37
9 0.36
10 0.33
11 0.25
12 0.2
13 0.18
14 0.16
15 0.13
16 0.15
17 0.15
18 0.15
19 0.14
20 0.13
21 0.1
22 0.09
23 0.09
24 0.07
25 0.07
26 0.07
27 0.08
28 0.09
29 0.1
30 0.1
31 0.11
32 0.17
33 0.2
34 0.29
35 0.32
36 0.36
37 0.4
38 0.45
39 0.47
40 0.43
41 0.41
42 0.33
43 0.29
44 0.25
45 0.27
46 0.26
47 0.26
48 0.29
49 0.32
50 0.32
51 0.34
52 0.36
53 0.31
54 0.29
55 0.3
56 0.28
57 0.3
58 0.38
59 0.36
60 0.38
61 0.38
62 0.35
63 0.32
64 0.31
65 0.3
66 0.31
67 0.41
68 0.46
69 0.54
70 0.62
71 0.63
72 0.67
73 0.7
74 0.72
75 0.71
76 0.71
77 0.72
78 0.72
79 0.81
80 0.85
81 0.86
82 0.8
83 0.77
84 0.76
85 0.7
86 0.68
87 0.66
88 0.66
89 0.65
90 0.71
91 0.73
92 0.73
93 0.8
94 0.8
95 0.77
96 0.79
97 0.79
98 0.8
99 0.79
100 0.75
101 0.73
102 0.73