Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4M252

Protein Details
Accession A0A4V4M252    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
196-255DEDSSEYRRKKRKFNQPLDDFYRWQRRDKKRHDLAHLRLKFENDKRKVEDSKQNRRYKPYBasic
NLS Segment(s)
PositionSequence
205-207KKR
224-226KKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR040446  RRP7  
IPR024326  RRP7_C  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF12923  RRP7  
Amino Acid Sequences MAKSDKQHIANRSISDHFPSDRTIFVTQLPIDMNDEDIYNTFNNVAEIDSMRRSSLALSTIDYPSGNDQQDKLNHLSNFNRNVHLILKTEKDLTKILNSNKIKLENHSLNTTTSLIQLYKSLRPNHNDIRSFSTNYIKQFEQDQIIEKNRQISNEIESKMEDDGFTLVERGGKHGRAANEAGVQVASKLFNGGKVDEDSSEYRRKKRKFNQPLDDFYRWQRRDKKRHDLAHLRLKFENDKRKVEDSKQNRRYKPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.39
4 0.34
5 0.3
6 0.32
7 0.28
8 0.26
9 0.28
10 0.25
11 0.22
12 0.22
13 0.25
14 0.21
15 0.22
16 0.21
17 0.18
18 0.19
19 0.18
20 0.18
21 0.14
22 0.14
23 0.12
24 0.11
25 0.13
26 0.1
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.1
35 0.12
36 0.13
37 0.14
38 0.14
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.12
45 0.13
46 0.16
47 0.16
48 0.17
49 0.16
50 0.14
51 0.16
52 0.2
53 0.19
54 0.18
55 0.18
56 0.23
57 0.26
58 0.29
59 0.28
60 0.29
61 0.28
62 0.31
63 0.36
64 0.37
65 0.42
66 0.39
67 0.38
68 0.33
69 0.33
70 0.32
71 0.28
72 0.24
73 0.19
74 0.2
75 0.19
76 0.23
77 0.22
78 0.22
79 0.21
80 0.2
81 0.23
82 0.26
83 0.27
84 0.33
85 0.33
86 0.35
87 0.37
88 0.4
89 0.35
90 0.33
91 0.38
92 0.33
93 0.34
94 0.33
95 0.31
96 0.26
97 0.27
98 0.25
99 0.18
100 0.14
101 0.12
102 0.1
103 0.09
104 0.12
105 0.12
106 0.16
107 0.22
108 0.26
109 0.29
110 0.32
111 0.38
112 0.43
113 0.48
114 0.46
115 0.42
116 0.45
117 0.43
118 0.42
119 0.37
120 0.35
121 0.31
122 0.3
123 0.31
124 0.23
125 0.21
126 0.22
127 0.22
128 0.19
129 0.17
130 0.18
131 0.19
132 0.22
133 0.23
134 0.22
135 0.27
136 0.25
137 0.25
138 0.24
139 0.21
140 0.22
141 0.26
142 0.26
143 0.2
144 0.2
145 0.2
146 0.18
147 0.17
148 0.13
149 0.07
150 0.07
151 0.07
152 0.07
153 0.06
154 0.06
155 0.08
156 0.08
157 0.12
158 0.15
159 0.15
160 0.17
161 0.2
162 0.21
163 0.22
164 0.24
165 0.21
166 0.21
167 0.2
168 0.18
169 0.15
170 0.13
171 0.1
172 0.09
173 0.08
174 0.05
175 0.07
176 0.07
177 0.1
178 0.12
179 0.12
180 0.14
181 0.15
182 0.17
183 0.15
184 0.19
185 0.19
186 0.22
187 0.31
188 0.33
189 0.4
190 0.49
191 0.54
192 0.62
193 0.69
194 0.76
195 0.78
196 0.84
197 0.87
198 0.85
199 0.88
200 0.85
201 0.79
202 0.71
203 0.68
204 0.68
205 0.59
206 0.6
207 0.62
208 0.64
209 0.71
210 0.78
211 0.81
212 0.8
213 0.87
214 0.88
215 0.88
216 0.87
217 0.87
218 0.81
219 0.74
220 0.66
221 0.62
222 0.61
223 0.6
224 0.61
225 0.57
226 0.6
227 0.62
228 0.68
229 0.7
230 0.69
231 0.71
232 0.71
233 0.75
234 0.78
235 0.82