Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0NB53

Protein Details
Accession A0A4T0NB53   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-113EKNKKGADTKHKDKKYRRGDKEDDKDGKBasic
NLS Segment(s)
PositionSequence
86-106EKNKKGADTKHKDKKYRRGDK
Subcellular Location(s) cyto 15, cyto_nucl 9.833, cyto_mito 9.333, nucl 3.5, extr 3, mito 2.5
Family & Domain DBs
Amino Acid Sequences MFFNVAKATAVLAFTAAIASAAATPHTGVRRGDDKDYGKSTKEYYGDGQKKDYKDGKHEEDSYAEQLKKHEEEVEKQLKLTKETAEKNKKGADTKHKDKKYRRGDKEDDKDGKHDDKKSTVYQKPSSTKSGEYAKFTDYWKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.1
13 0.12
14 0.15
15 0.14
16 0.19
17 0.25
18 0.28
19 0.3
20 0.34
21 0.36
22 0.39
23 0.44
24 0.41
25 0.37
26 0.36
27 0.35
28 0.33
29 0.31
30 0.27
31 0.25
32 0.34
33 0.38
34 0.37
35 0.4
36 0.4
37 0.4
38 0.45
39 0.46
40 0.38
41 0.4
42 0.45
43 0.46
44 0.46
45 0.46
46 0.4
47 0.37
48 0.36
49 0.31
50 0.29
51 0.23
52 0.19
53 0.18
54 0.2
55 0.18
56 0.17
57 0.19
58 0.16
59 0.19
60 0.26
61 0.32
62 0.29
63 0.29
64 0.32
65 0.28
66 0.29
67 0.27
68 0.22
69 0.23
70 0.29
71 0.4
72 0.45
73 0.46
74 0.47
75 0.5
76 0.5
77 0.48
78 0.49
79 0.5
80 0.5
81 0.59
82 0.66
83 0.7
84 0.75
85 0.79
86 0.82
87 0.82
88 0.84
89 0.83
90 0.82
91 0.84
92 0.86
93 0.85
94 0.85
95 0.8
96 0.71
97 0.65
98 0.6
99 0.59
100 0.55
101 0.52
102 0.46
103 0.46
104 0.49
105 0.54
106 0.58
107 0.57
108 0.58
109 0.6
110 0.64
111 0.66
112 0.66
113 0.63
114 0.56
115 0.52
116 0.5
117 0.53
118 0.48
119 0.46
120 0.44
121 0.41
122 0.41