Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0QFG0

Protein Details
Accession A0A4T0QFG0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-90MELIRNSKDKKARKLTKKRLGTLRRAKGKVBasic
NLS Segment(s)
PositionSequence
25-41KRVKPSHRKGANSERGR
65-89RNSKDKKARKLTKKRLGTLRRAKGK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MNLSTTTNNLRVGLNKGFPTTQLPKRVKPSHRKGANSERGRLVKGVVREVAGFAPYEKRVMELIRNSKDKKARKLTKKRLGTLRRAKGKVEELSTVIQEARTKGTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.28
4 0.27
5 0.27
6 0.31
7 0.34
8 0.36
9 0.41
10 0.45
11 0.49
12 0.58
13 0.66
14 0.68
15 0.71
16 0.75
17 0.75
18 0.79
19 0.77
20 0.75
21 0.77
22 0.78
23 0.71
24 0.65
25 0.6
26 0.54
27 0.51
28 0.43
29 0.34
30 0.26
31 0.23
32 0.22
33 0.16
34 0.15
35 0.14
36 0.14
37 0.13
38 0.1
39 0.08
40 0.06
41 0.08
42 0.08
43 0.09
44 0.08
45 0.09
46 0.1
47 0.11
48 0.15
49 0.19
50 0.27
51 0.32
52 0.38
53 0.38
54 0.43
55 0.51
56 0.54
57 0.57
58 0.61
59 0.65
60 0.71
61 0.81
62 0.86
63 0.88
64 0.89
65 0.87
66 0.86
67 0.84
68 0.84
69 0.83
70 0.82
71 0.82
72 0.75
73 0.69
74 0.65
75 0.64
76 0.59
77 0.52
78 0.45
79 0.37
80 0.37
81 0.36
82 0.3
83 0.23
84 0.2
85 0.18
86 0.18