Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0LWD2

Protein Details
Accession A0A4T0LWD2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-129KDDKKDVKKDDKKDDKKDDKKDDKKDDKKDDKKDDKYDKGBasic
NLS Segment(s)
PositionSequence
91-145DDKKDVKKDDKKDDKKDDKKDDKKDDKKDDKKDDKYDKGVKKDDHKDVKKDDHKD
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences KHDDKKSTVYQKPSSTKSGEYAKFTDYWKSKYDDKDDNEKGKKDDKKEGKVVKLDDKKAGYNDKDYYKNLQAQKQNTKEYEEAVKKYGIKDDKKDVKKDDKKDDKKDDKKDDKKDDKKDDKKDDKYDKGVKKDDHKDVKKDDHKDAKKDDKDNVDHEKYDKKHDKANKASYNKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.55
4 0.52
5 0.54
6 0.49
7 0.46
8 0.43
9 0.4
10 0.39
11 0.38
12 0.41
13 0.36
14 0.36
15 0.35
16 0.37
17 0.4
18 0.44
19 0.5
20 0.5
21 0.51
22 0.57
23 0.61
24 0.66
25 0.66
26 0.62
27 0.59
28 0.59
29 0.6
30 0.56
31 0.59
32 0.59
33 0.6
34 0.67
35 0.7
36 0.67
37 0.66
38 0.64
39 0.63
40 0.62
41 0.57
42 0.52
43 0.47
44 0.44
45 0.42
46 0.45
47 0.37
48 0.34
49 0.35
50 0.35
51 0.36
52 0.36
53 0.37
54 0.35
55 0.4
56 0.39
57 0.41
58 0.42
59 0.46
60 0.53
61 0.54
62 0.54
63 0.49
64 0.48
65 0.42
66 0.38
67 0.39
68 0.33
69 0.28
70 0.25
71 0.26
72 0.23
73 0.23
74 0.27
75 0.26
76 0.26
77 0.28
78 0.36
79 0.44
80 0.48
81 0.52
82 0.52
83 0.57
84 0.62
85 0.66
86 0.67
87 0.69
88 0.73
89 0.78
90 0.83
91 0.83
92 0.83
93 0.86
94 0.85
95 0.85
96 0.85
97 0.86
98 0.86
99 0.86
100 0.86
101 0.86
102 0.86
103 0.86
104 0.86
105 0.86
106 0.86
107 0.85
108 0.84
109 0.84
110 0.83
111 0.78
112 0.77
113 0.77
114 0.74
115 0.72
116 0.71
117 0.66
118 0.66
119 0.69
120 0.7
121 0.72
122 0.71
123 0.7
124 0.7
125 0.76
126 0.75
127 0.72
128 0.71
129 0.71
130 0.72
131 0.72
132 0.74
133 0.74
134 0.74
135 0.73
136 0.7
137 0.68
138 0.66
139 0.65
140 0.65
141 0.59
142 0.53
143 0.52
144 0.54
145 0.47
146 0.54
147 0.57
148 0.5
149 0.55
150 0.62
151 0.69
152 0.7
153 0.79
154 0.78