Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0MNE0

Protein Details
Accession A0A4T0MNE0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
14-36HLTARDRKNKKLVKKLAKSQDAFHydrophilic
NLS Segment(s)
PositionSequence
21-25KNKKL
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
IPR023673  Ribosomal_L1_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
PROSITE View protein in PROSITE  
PS01199  RIBOSOMAL_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MCHNNDTGLNIQHHLTARDRKNKKLVKKLAKSQDAFITSEALIKQIPRLLGPGLSKAGKFPTPISHSDDIEQKINDVKSTIKFQLKEVLCMGVAVDEIVAKVVLAVNFLVSLLKKNWQNVKSLHLKSTMGKAHRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.33
4 0.4
5 0.49
6 0.53
7 0.57
8 0.66
9 0.71
10 0.75
11 0.76
12 0.78
13 0.79
14 0.83
15 0.86
16 0.85
17 0.86
18 0.77
19 0.69
20 0.65
21 0.56
22 0.48
23 0.39
24 0.31
25 0.22
26 0.22
27 0.19
28 0.13
29 0.11
30 0.1
31 0.11
32 0.11
33 0.11
34 0.09
35 0.11
36 0.11
37 0.13
38 0.14
39 0.14
40 0.15
41 0.15
42 0.15
43 0.14
44 0.16
45 0.14
46 0.15
47 0.14
48 0.18
49 0.21
50 0.23
51 0.28
52 0.28
53 0.27
54 0.28
55 0.3
56 0.26
57 0.24
58 0.22
59 0.16
60 0.17
61 0.17
62 0.16
63 0.12
64 0.13
65 0.13
66 0.18
67 0.22
68 0.23
69 0.23
70 0.24
71 0.32
72 0.31
73 0.31
74 0.27
75 0.24
76 0.19
77 0.18
78 0.17
79 0.08
80 0.08
81 0.05
82 0.04
83 0.03
84 0.03
85 0.04
86 0.03
87 0.03
88 0.03
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.06
98 0.09
99 0.1
100 0.16
101 0.19
102 0.26
103 0.35
104 0.36
105 0.42
106 0.41
107 0.47
108 0.51
109 0.51
110 0.48
111 0.43
112 0.43
113 0.4
114 0.47
115 0.46
116 0.39