Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0PNP1

Protein Details
Accession A0A4T0PNP1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-170PSTPKRPRRLSPPGQPRHRKVBasic
NLS Segment(s)
PositionSequence
153-183PKRPRRLSPPGQPRHRKVSDFFKKIDEKGAK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010666  Znf_GRF  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51999  ZF_GRF  
Amino Acid Sequences MISVRKAIKSLDKDLGWPLCSHGERVQLLLSETEMNPNRLLYRCRKTDLESCRYFIWVDDFEKAADNQLNNENYTLRTRRRHILDACKRRNDANKLSRWSTKLVDDVLAEFDKHDDEITNFSDDDDFIESSRQPNKRLYDVDSDNKEELPSTPKRPRRLSPPGQPRHRKVSDFFKKIDEKGAKRERSDTNAQLDTNELINYVKSTERSHAGLAQELEEAKGEIRKLKKEALLYFKNSALDPYSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.4
4 0.34
5 0.3
6 0.31
7 0.31
8 0.33
9 0.29
10 0.32
11 0.31
12 0.32
13 0.31
14 0.24
15 0.24
16 0.21
17 0.19
18 0.15
19 0.14
20 0.21
21 0.22
22 0.23
23 0.22
24 0.23
25 0.25
26 0.26
27 0.32
28 0.33
29 0.39
30 0.42
31 0.46
32 0.48
33 0.51
34 0.55
35 0.59
36 0.59
37 0.53
38 0.51
39 0.47
40 0.45
41 0.39
42 0.31
43 0.27
44 0.21
45 0.2
46 0.19
47 0.19
48 0.18
49 0.19
50 0.19
51 0.17
52 0.16
53 0.15
54 0.15
55 0.21
56 0.22
57 0.21
58 0.22
59 0.19
60 0.18
61 0.24
62 0.27
63 0.27
64 0.33
65 0.36
66 0.43
67 0.47
68 0.54
69 0.55
70 0.61
71 0.65
72 0.7
73 0.73
74 0.71
75 0.67
76 0.64
77 0.65
78 0.62
79 0.61
80 0.58
81 0.58
82 0.58
83 0.6
84 0.59
85 0.52
86 0.48
87 0.4
88 0.33
89 0.27
90 0.23
91 0.2
92 0.17
93 0.15
94 0.14
95 0.13
96 0.11
97 0.09
98 0.08
99 0.07
100 0.07
101 0.07
102 0.05
103 0.05
104 0.08
105 0.09
106 0.1
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.08
113 0.07
114 0.06
115 0.08
116 0.08
117 0.11
118 0.17
119 0.18
120 0.19
121 0.25
122 0.27
123 0.31
124 0.33
125 0.34
126 0.34
127 0.37
128 0.41
129 0.39
130 0.39
131 0.35
132 0.33
133 0.29
134 0.22
135 0.18
136 0.18
137 0.19
138 0.24
139 0.33
140 0.39
141 0.46
142 0.52
143 0.56
144 0.6
145 0.66
146 0.67
147 0.69
148 0.74
149 0.76
150 0.8
151 0.84
152 0.8
153 0.79
154 0.75
155 0.67
156 0.61
157 0.63
158 0.63
159 0.59
160 0.55
161 0.53
162 0.52
163 0.5
164 0.55
165 0.52
166 0.44
167 0.5
168 0.58
169 0.56
170 0.54
171 0.59
172 0.55
173 0.53
174 0.57
175 0.52
176 0.49
177 0.47
178 0.45
179 0.39
180 0.36
181 0.3
182 0.24
183 0.18
184 0.12
185 0.09
186 0.1
187 0.1
188 0.1
189 0.11
190 0.12
191 0.15
192 0.18
193 0.21
194 0.23
195 0.24
196 0.27
197 0.26
198 0.28
199 0.26
200 0.23
201 0.21
202 0.19
203 0.18
204 0.14
205 0.13
206 0.1
207 0.13
208 0.13
209 0.18
210 0.24
211 0.3
212 0.33
213 0.39
214 0.43
215 0.48
216 0.54
217 0.57
218 0.58
219 0.58
220 0.57
221 0.53
222 0.5
223 0.43
224 0.38
225 0.31