Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0NYB3

Protein Details
Accession A0A4T0NYB3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
120-147RDRYERPHQMRRRLKSERHRRRFAEYIRBasic
NLS Segment(s)
PositionSequence
127-142HQMRRRLKSERHRRRF
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MNFLRNISTNLRTNAVKSMRTYSTQPRISLANLINSGSKPNSQDPLTGTRALTPEEIWAQAHQQRMRTLAQEQPLSLYAGRTVVVGKYDKNSATSQVERAWKRLNGTLARNEVRRDLMLRDRYERPHQMRRRLKSERHRRRFAEYIRQKVSLVHSIRRRNEMLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.36
4 0.33
5 0.37
6 0.36
7 0.38
8 0.42
9 0.42
10 0.48
11 0.49
12 0.47
13 0.43
14 0.42
15 0.4
16 0.41
17 0.33
18 0.29
19 0.25
20 0.25
21 0.25
22 0.23
23 0.25
24 0.2
25 0.2
26 0.18
27 0.21
28 0.24
29 0.23
30 0.25
31 0.25
32 0.3
33 0.31
34 0.29
35 0.26
36 0.24
37 0.25
38 0.24
39 0.21
40 0.15
41 0.14
42 0.13
43 0.14
44 0.12
45 0.11
46 0.13
47 0.15
48 0.21
49 0.2
50 0.22
51 0.22
52 0.25
53 0.26
54 0.24
55 0.23
56 0.22
57 0.24
58 0.22
59 0.21
60 0.19
61 0.19
62 0.18
63 0.16
64 0.12
65 0.08
66 0.07
67 0.08
68 0.06
69 0.06
70 0.05
71 0.07
72 0.08
73 0.08
74 0.09
75 0.11
76 0.11
77 0.14
78 0.14
79 0.16
80 0.19
81 0.2
82 0.2
83 0.23
84 0.3
85 0.28
86 0.31
87 0.32
88 0.29
89 0.31
90 0.32
91 0.34
92 0.31
93 0.34
94 0.36
95 0.38
96 0.4
97 0.39
98 0.37
99 0.33
100 0.3
101 0.27
102 0.23
103 0.21
104 0.27
105 0.32
106 0.33
107 0.37
108 0.39
109 0.44
110 0.5
111 0.55
112 0.54
113 0.58
114 0.63
115 0.69
116 0.75
117 0.77
118 0.79
119 0.79
120 0.81
121 0.82
122 0.85
123 0.86
124 0.86
125 0.88
126 0.82
127 0.81
128 0.81
129 0.77
130 0.77
131 0.75
132 0.75
133 0.7
134 0.68
135 0.6
136 0.54
137 0.52
138 0.49
139 0.44
140 0.43
141 0.47
142 0.55
143 0.6
144 0.63
145 0.61