Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4N1N2

Protein Details
Accession A0A4V4N1N2   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
241-268DAFRSAKLKSNKLKKARKTTEKMNEKMTHydrophilic
NLS Segment(s)
PositionSequence
237-260AKRKDAFRSAKLKSNKLKKARKTT
Subcellular Location(s) nucl 18, cyto 6, mito 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008984  SMAD_FHA_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MELKLKLESGDTIPISDNQKIGRKLFKDYPQSKTISKNHGQIYLDRYLVMYEDLGSLHGSYIIKDGKPTKITPYEPLEIGRGVKLQLAKHLQAHGGRYKPMTFTVEAEPDFRSTSFSARFSDIMDSDDIEEVSSNKQSDNKKPLVEKVDSGELSDDSELFEPSSALNPAPGYTASDYASDSKESDNNVDSELDERLNELECIIAEHDGSLEKIDNSMRQIKVQSFKNAIIYKRLQVAKRKDAFRSAKLKSNKLKKARKTTEKMNEKMTEKMTEKRIEKPSNYNQSLTAGIIGGAIGVSLGAAATITFLLNLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.28
4 0.28
5 0.27
6 0.34
7 0.37
8 0.4
9 0.45
10 0.43
11 0.49
12 0.55
13 0.59
14 0.62
15 0.63
16 0.65
17 0.62
18 0.64
19 0.6
20 0.61
21 0.6
22 0.58
23 0.58
24 0.59
25 0.56
26 0.58
27 0.56
28 0.51
29 0.49
30 0.44
31 0.38
32 0.31
33 0.27
34 0.21
35 0.2
36 0.16
37 0.11
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.07
45 0.1
46 0.09
47 0.09
48 0.13
49 0.16
50 0.16
51 0.2
52 0.24
53 0.27
54 0.31
55 0.32
56 0.34
57 0.38
58 0.41
59 0.42
60 0.45
61 0.41
62 0.39
63 0.38
64 0.33
65 0.27
66 0.26
67 0.2
68 0.15
69 0.13
70 0.14
71 0.16
72 0.15
73 0.21
74 0.25
75 0.25
76 0.27
77 0.28
78 0.29
79 0.28
80 0.32
81 0.31
82 0.28
83 0.28
84 0.27
85 0.27
86 0.25
87 0.25
88 0.24
89 0.19
90 0.2
91 0.21
92 0.22
93 0.22
94 0.22
95 0.2
96 0.18
97 0.18
98 0.15
99 0.15
100 0.12
101 0.15
102 0.17
103 0.18
104 0.19
105 0.19
106 0.2
107 0.18
108 0.19
109 0.16
110 0.15
111 0.13
112 0.11
113 0.1
114 0.1
115 0.09
116 0.07
117 0.07
118 0.06
119 0.07
120 0.08
121 0.08
122 0.08
123 0.14
124 0.18
125 0.26
126 0.32
127 0.35
128 0.36
129 0.38
130 0.42
131 0.42
132 0.39
133 0.32
134 0.27
135 0.28
136 0.25
137 0.23
138 0.19
139 0.13
140 0.13
141 0.12
142 0.09
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.08
160 0.09
161 0.09
162 0.1
163 0.1
164 0.11
165 0.12
166 0.11
167 0.11
168 0.1
169 0.12
170 0.12
171 0.13
172 0.13
173 0.12
174 0.13
175 0.12
176 0.11
177 0.11
178 0.11
179 0.09
180 0.08
181 0.08
182 0.07
183 0.08
184 0.08
185 0.06
186 0.06
187 0.05
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.07
200 0.09
201 0.1
202 0.13
203 0.2
204 0.2
205 0.21
206 0.24
207 0.28
208 0.34
209 0.38
210 0.4
211 0.37
212 0.37
213 0.43
214 0.44
215 0.41
216 0.41
217 0.38
218 0.35
219 0.39
220 0.43
221 0.4
222 0.45
223 0.53
224 0.56
225 0.61
226 0.63
227 0.58
228 0.63
229 0.64
230 0.63
231 0.64
232 0.57
233 0.58
234 0.61
235 0.66
236 0.66
237 0.7
238 0.72
239 0.73
240 0.8
241 0.81
242 0.86
243 0.87
244 0.89
245 0.86
246 0.87
247 0.87
248 0.87
249 0.81
250 0.78
251 0.74
252 0.65
253 0.63
254 0.56
255 0.53
256 0.46
257 0.49
258 0.48
259 0.5
260 0.5
261 0.53
262 0.6
263 0.61
264 0.62
265 0.65
266 0.68
267 0.71
268 0.72
269 0.64
270 0.55
271 0.5
272 0.46
273 0.37
274 0.27
275 0.16
276 0.13
277 0.11
278 0.09
279 0.07
280 0.05
281 0.04
282 0.03
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.02
290 0.03
291 0.04
292 0.04