Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0NWL5

Protein Details
Accession A0A4T0NWL5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
129-155ILQAKKSGKKGAKKSNNSNSKKKSPVNHydrophilic
NLS Segment(s)
PositionSequence
132-151AKKSGKKGAKKSNNSNSKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00929  RNase_T  
Amino Acid Sequences MEKVTDFRTWVSGVTFKDVEKAPLFSEVQQHVADLLEGRILIGHAINNDLRALLLTHPPSHIRDTAKYEQLHTIAKTKRPKLKALAKLVLGIDIQENEHSSVIDAQATMEVYKRYQSLWEGTLARQAKILQAKKSGKKGAKKSNNSNSKKKSPVNLNSAAPTASSASSSDWWNESAMTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.23
4 0.27
5 0.27
6 0.28
7 0.26
8 0.26
9 0.21
10 0.25
11 0.26
12 0.23
13 0.29
14 0.26
15 0.27
16 0.25
17 0.24
18 0.19
19 0.18
20 0.17
21 0.11
22 0.09
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.08
38 0.07
39 0.08
40 0.07
41 0.12
42 0.13
43 0.14
44 0.16
45 0.18
46 0.2
47 0.22
48 0.24
49 0.22
50 0.24
51 0.32
52 0.35
53 0.39
54 0.38
55 0.36
56 0.35
57 0.34
58 0.32
59 0.25
60 0.28
61 0.25
62 0.31
63 0.38
64 0.42
65 0.48
66 0.49
67 0.52
68 0.54
69 0.6
70 0.61
71 0.61
72 0.57
73 0.5
74 0.48
75 0.43
76 0.35
77 0.25
78 0.17
79 0.1
80 0.07
81 0.07
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.08
100 0.09
101 0.08
102 0.1
103 0.12
104 0.14
105 0.14
106 0.18
107 0.18
108 0.18
109 0.25
110 0.24
111 0.22
112 0.21
113 0.2
114 0.21
115 0.28
116 0.33
117 0.29
118 0.38
119 0.46
120 0.51
121 0.58
122 0.62
123 0.61
124 0.66
125 0.72
126 0.74
127 0.76
128 0.79
129 0.82
130 0.84
131 0.87
132 0.86
133 0.86
134 0.83
135 0.82
136 0.81
137 0.76
138 0.74
139 0.74
140 0.76
141 0.73
142 0.71
143 0.65
144 0.58
145 0.54
146 0.45
147 0.34
148 0.27
149 0.2
150 0.15
151 0.13
152 0.11
153 0.13
154 0.15
155 0.16
156 0.17
157 0.17
158 0.18
159 0.17
160 0.17