Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0TXC7

Protein Details
Accession A0A4T0TXC7   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-152KDKTHLVRGGTRPKKQRRLFYLDBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001971  Ribosomal_S11  
IPR036967  Ribosomal_S11_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00411  Ribosomal_S11  
Amino Acid Sequences MNNFAKNLNSKLQFINYNKTAHKSIINVHSTRNNTIITLTNNNNQPITWLSSGSIGFKSSQKSGYEAGYQSTIKLFDMINQSSPDSPLHQSKFGPIEMHFRGFGQGRFASWAALLSQQGESFKQRLTLIKDKTHLVRGGTRPKKQRRLFYLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.44
4 0.46
5 0.45
6 0.47
7 0.44
8 0.38
9 0.38
10 0.31
11 0.34
12 0.38
13 0.42
14 0.38
15 0.39
16 0.44
17 0.44
18 0.43
19 0.39
20 0.3
21 0.25
22 0.26
23 0.26
24 0.23
25 0.25
26 0.26
27 0.29
28 0.32
29 0.33
30 0.31
31 0.27
32 0.25
33 0.21
34 0.23
35 0.18
36 0.15
37 0.14
38 0.16
39 0.17
40 0.16
41 0.15
42 0.11
43 0.12
44 0.13
45 0.15
46 0.15
47 0.18
48 0.17
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.16
56 0.15
57 0.13
58 0.13
59 0.11
60 0.08
61 0.09
62 0.08
63 0.09
64 0.14
65 0.14
66 0.15
67 0.16
68 0.16
69 0.15
70 0.17
71 0.14
72 0.12
73 0.14
74 0.18
75 0.19
76 0.21
77 0.2
78 0.22
79 0.24
80 0.23
81 0.22
82 0.17
83 0.22
84 0.22
85 0.23
86 0.2
87 0.18
88 0.2
89 0.2
90 0.19
91 0.17
92 0.16
93 0.15
94 0.18
95 0.18
96 0.15
97 0.14
98 0.14
99 0.1
100 0.11
101 0.11
102 0.09
103 0.1
104 0.11
105 0.12
106 0.13
107 0.16
108 0.15
109 0.16
110 0.18
111 0.19
112 0.24
113 0.31
114 0.38
115 0.41
116 0.46
117 0.48
118 0.49
119 0.51
120 0.52
121 0.47
122 0.42
123 0.44
124 0.46
125 0.55
126 0.59
127 0.64
128 0.68
129 0.76
130 0.83
131 0.83
132 0.85