Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0QLU3

Protein Details
Accession A0A4T0QLU3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-70SGLSNKLRNRSPRRTQQQPVHydrophilic
92-118TAENKKQSHKSQQRRSKKPTNSKKEEEHydrophilic
NLS Segment(s)
PositionSequence
96-124KKQSHKSQQRRSKKPTNSKKEEEGKDKQR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MLRTLVRGTGRGSTRPLVIGDETIDLRAFRNTPAKGFVPEKPDRSSLQGESGLSNKLRNRSPRRTQQQPVAGQFDDADHKELLNTLGERKITAENKKQSHKSQQRRSKKPTNSKKEEEGKDKQRRAYAQYTPPTDLQTRQPKETKEPRKPKLKEIEIDRVDLSSLIFETGEADIMPTNKNFNEPATLSEEERRKQHMELVGGDYERYAKYNTPLQHAISAQRMYTLSQRDELVNNIKKFTKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.27
5 0.24
6 0.22
7 0.19
8 0.19
9 0.17
10 0.16
11 0.16
12 0.13
13 0.13
14 0.15
15 0.14
16 0.16
17 0.23
18 0.24
19 0.26
20 0.31
21 0.32
22 0.34
23 0.37
24 0.37
25 0.38
26 0.43
27 0.45
28 0.43
29 0.45
30 0.41
31 0.43
32 0.43
33 0.36
34 0.34
35 0.33
36 0.29
37 0.28
38 0.27
39 0.26
40 0.21
41 0.24
42 0.23
43 0.26
44 0.31
45 0.4
46 0.48
47 0.55
48 0.64
49 0.71
50 0.76
51 0.8
52 0.8
53 0.79
54 0.78
55 0.74
56 0.68
57 0.62
58 0.53
59 0.44
60 0.38
61 0.3
62 0.25
63 0.19
64 0.17
65 0.13
66 0.12
67 0.12
68 0.13
69 0.12
70 0.11
71 0.11
72 0.1
73 0.12
74 0.13
75 0.13
76 0.14
77 0.19
78 0.23
79 0.29
80 0.36
81 0.41
82 0.47
83 0.54
84 0.57
85 0.56
86 0.62
87 0.66
88 0.68
89 0.71
90 0.76
91 0.8
92 0.84
93 0.88
94 0.86
95 0.86
96 0.86
97 0.87
98 0.87
99 0.84
100 0.79
101 0.78
102 0.77
103 0.73
104 0.69
105 0.67
106 0.67
107 0.68
108 0.67
109 0.61
110 0.56
111 0.52
112 0.5
113 0.48
114 0.44
115 0.43
116 0.45
117 0.45
118 0.43
119 0.42
120 0.39
121 0.33
122 0.29
123 0.29
124 0.34
125 0.34
126 0.37
127 0.4
128 0.4
129 0.48
130 0.56
131 0.59
132 0.59
133 0.67
134 0.7
135 0.77
136 0.77
137 0.77
138 0.77
139 0.73
140 0.68
141 0.64
142 0.67
143 0.58
144 0.57
145 0.48
146 0.37
147 0.31
148 0.25
149 0.18
150 0.08
151 0.07
152 0.05
153 0.05
154 0.04
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.06
161 0.07
162 0.09
163 0.08
164 0.1
165 0.1
166 0.13
167 0.13
168 0.13
169 0.17
170 0.17
171 0.19
172 0.22
173 0.24
174 0.23
175 0.29
176 0.34
177 0.32
178 0.35
179 0.37
180 0.33
181 0.33
182 0.37
183 0.36
184 0.34
185 0.34
186 0.34
187 0.32
188 0.3
189 0.29
190 0.23
191 0.2
192 0.17
193 0.15
194 0.13
195 0.13
196 0.17
197 0.24
198 0.27
199 0.32
200 0.35
201 0.35
202 0.38
203 0.37
204 0.37
205 0.37
206 0.35
207 0.28
208 0.27
209 0.26
210 0.23
211 0.28
212 0.3
213 0.26
214 0.27
215 0.29
216 0.29
217 0.3
218 0.33
219 0.37
220 0.4
221 0.39
222 0.41
223 0.43