Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TLF0

Protein Details
Accession G4TLF0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCRKHTPHKVTQYKKGKDSLSVQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLALKRCKHFELGGDKKTKGAALTFILLSALYAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.89
9 0.88
10 0.89
11 0.9
12 0.86
13 0.88
14 0.87
15 0.82
16 0.76
17 0.72
18 0.62
19 0.57
20 0.55
21 0.54
22 0.54
23 0.54
24 0.55
25 0.56
26 0.59
27 0.59
28 0.62
29 0.59
30 0.59
31 0.61
32 0.62
33 0.63
34 0.62
35 0.63
36 0.61
37 0.61
38 0.52
39 0.46
40 0.42
41 0.35
42 0.37
43 0.38
44 0.36
45 0.3
46 0.36
47 0.4
48 0.48
49 0.57
50 0.59
51 0.59
52 0.62
53 0.69
54 0.7
55 0.68
56 0.64
57 0.59
58 0.56
59 0.54
60 0.49
61 0.44
62 0.41
63 0.35
64 0.3
65 0.28
66 0.27
67 0.31
68 0.37
69 0.39
70 0.43
71 0.53
72 0.6
73 0.64
74 0.62
75 0.56
76 0.52
77 0.47
78 0.45
79 0.46
80 0.46
81 0.48
82 0.51
83 0.49
84 0.46
85 0.46
86 0.4
87 0.3
88 0.23
89 0.19
90 0.17
91 0.2
92 0.19
93 0.18
94 0.16
95 0.15
96 0.13