Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0P421

Protein Details
Accession A0A4T0P421    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
117-136AEEHKAKKRAKKGADVGNNSHydrophilic
NLS Segment(s)
PositionSequence
119-129EHKAKKRAKKG
Subcellular Location(s) E.R. 7, mito 6, extr 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MLGGTISLALCDTIVRNTLIKGLRSRSLDETKIDEITTDPTSIGMIEGINTSEVLQTYCNGIRNVFILFTACSGASFLISLLIKQCECTQAVIADGMMNQLERPDDKVLKEEGKAWAEEHKAKKRAKKGADVGNNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.12
5 0.18
6 0.21
7 0.24
8 0.27
9 0.3
10 0.34
11 0.36
12 0.4
13 0.41
14 0.43
15 0.42
16 0.39
17 0.4
18 0.36
19 0.34
20 0.3
21 0.23
22 0.18
23 0.19
24 0.18
25 0.13
26 0.11
27 0.1
28 0.1
29 0.1
30 0.09
31 0.06
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.08
45 0.1
46 0.13
47 0.12
48 0.12
49 0.12
50 0.13
51 0.13
52 0.1
53 0.08
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.09
71 0.1
72 0.1
73 0.1
74 0.11
75 0.12
76 0.11
77 0.1
78 0.11
79 0.1
80 0.09
81 0.08
82 0.07
83 0.06
84 0.06
85 0.05
86 0.04
87 0.05
88 0.06
89 0.07
90 0.1
91 0.15
92 0.17
93 0.18
94 0.22
95 0.26
96 0.27
97 0.28
98 0.28
99 0.29
100 0.29
101 0.28
102 0.26
103 0.28
104 0.3
105 0.37
106 0.43
107 0.47
108 0.53
109 0.59
110 0.67
111 0.71
112 0.75
113 0.75
114 0.76
115 0.75
116 0.78
117 0.81