Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0N098

Protein Details
Accession A0A4T0N098    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-37DVNEAPENKRDKKRRDLVEKLNKQSAEHydrophilic
NLS Segment(s)
PositionSequence
274-280RKKRRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MSSAQFLELNDVNEAPENKRDKKRRDLVEKLNKQSAEIYDRRDLIFLEAHNAMTDVHNHLLSTSPTNPYEFTAAPSTGSLMTSREQNLRLYELSLERDAILSAIKHTYGYAMDSAKSLYEIERSRVEEEYDSVQRSIKTKLIDAIEEKKRKLKEEKDMEVGVESLLDATNFSRSTRTSRNRKSGNVSSSVGGTPSQQDPNESEATVPSSSYLGVAFEDILGSSSLNSVLGGKKKKTPAGPPGMTGPFLGLGRSINSGLTAAKDIDVDTDMMEIRKKRRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.26
4 0.31
5 0.39
6 0.49
7 0.59
8 0.63
9 0.72
10 0.78
11 0.81
12 0.84
13 0.85
14 0.86
15 0.88
16 0.89
17 0.85
18 0.82
19 0.71
20 0.62
21 0.56
22 0.49
23 0.46
24 0.4
25 0.39
26 0.37
27 0.39
28 0.38
29 0.35
30 0.31
31 0.25
32 0.25
33 0.19
34 0.18
35 0.17
36 0.17
37 0.16
38 0.16
39 0.14
40 0.12
41 0.13
42 0.12
43 0.13
44 0.13
45 0.13
46 0.13
47 0.15
48 0.15
49 0.18
50 0.17
51 0.19
52 0.2
53 0.21
54 0.22
55 0.21
56 0.23
57 0.19
58 0.19
59 0.19
60 0.18
61 0.17
62 0.17
63 0.16
64 0.13
65 0.13
66 0.11
67 0.09
68 0.1
69 0.12
70 0.15
71 0.17
72 0.18
73 0.2
74 0.21
75 0.22
76 0.21
77 0.19
78 0.18
79 0.17
80 0.18
81 0.17
82 0.15
83 0.13
84 0.12
85 0.11
86 0.09
87 0.08
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.09
104 0.08
105 0.06
106 0.11
107 0.12
108 0.14
109 0.17
110 0.19
111 0.2
112 0.2
113 0.21
114 0.16
115 0.16
116 0.18
117 0.17
118 0.16
119 0.15
120 0.15
121 0.15
122 0.17
123 0.17
124 0.16
125 0.15
126 0.15
127 0.18
128 0.18
129 0.18
130 0.19
131 0.25
132 0.3
133 0.32
134 0.32
135 0.34
136 0.35
137 0.38
138 0.44
139 0.44
140 0.46
141 0.52
142 0.55
143 0.54
144 0.53
145 0.48
146 0.4
147 0.33
148 0.22
149 0.13
150 0.08
151 0.04
152 0.04
153 0.04
154 0.03
155 0.04
156 0.06
157 0.07
158 0.07
159 0.09
160 0.1
161 0.16
162 0.26
163 0.35
164 0.44
165 0.52
166 0.61
167 0.65
168 0.68
169 0.71
170 0.69
171 0.63
172 0.57
173 0.5
174 0.41
175 0.37
176 0.33
177 0.25
178 0.17
179 0.14
180 0.12
181 0.13
182 0.16
183 0.15
184 0.17
185 0.18
186 0.22
187 0.23
188 0.2
189 0.18
190 0.15
191 0.18
192 0.16
193 0.14
194 0.1
195 0.09
196 0.09
197 0.09
198 0.08
199 0.06
200 0.06
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.11
216 0.19
217 0.25
218 0.27
219 0.34
220 0.4
221 0.46
222 0.51
223 0.56
224 0.59
225 0.63
226 0.62
227 0.57
228 0.58
229 0.54
230 0.48
231 0.39
232 0.29
233 0.21
234 0.19
235 0.17
236 0.11
237 0.1
238 0.11
239 0.14
240 0.13
241 0.11
242 0.11
243 0.12
244 0.12
245 0.12
246 0.13
247 0.11
248 0.11
249 0.12
250 0.11
251 0.12
252 0.13
253 0.11
254 0.09
255 0.1
256 0.11
257 0.12
258 0.17
259 0.21
260 0.29