Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0MWD2

Protein Details
Accession A0A4T0MWD2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
9-34AGKGGAKSKKKWSKGKVKDKAQNAVVHydrophilic
NLS Segment(s)
PositionSequence
10-27GKGGAKSKKKWSKGKVKD
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences AAAAANPSAGKGGAKSKKKWSKGKVKDKAQNAVVLDRPTYDRILKEVPTFKLISQSTLIDRLKINGSLARIAIRHLHREGAIRQIVHHNGQLIYTRSGQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.5
4 0.6
5 0.69
6 0.76
7 0.77
8 0.79
9 0.83
10 0.89
11 0.88
12 0.89
13 0.87
14 0.83
15 0.8
16 0.71
17 0.64
18 0.54
19 0.47
20 0.4
21 0.32
22 0.26
23 0.2
24 0.2
25 0.17
26 0.18
27 0.17
28 0.14
29 0.16
30 0.18
31 0.19
32 0.21
33 0.23
34 0.23
35 0.24
36 0.24
37 0.21
38 0.25
39 0.24
40 0.22
41 0.19
42 0.19
43 0.17
44 0.23
45 0.23
46 0.17
47 0.17
48 0.17
49 0.18
50 0.17
51 0.17
52 0.13
53 0.14
54 0.14
55 0.14
56 0.14
57 0.12
58 0.13
59 0.19
60 0.2
61 0.23
62 0.23
63 0.25
64 0.25
65 0.29
66 0.3
67 0.31
68 0.32
69 0.27
70 0.28
71 0.33
72 0.35
73 0.33
74 0.33
75 0.28
76 0.25
77 0.26
78 0.29
79 0.26
80 0.25