Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L4K0

Protein Details
Accession E2L4K0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
212-231AAHLRARKSKGRKAILRGMDHydrophilic
NLS Segment(s)
PositionSequence
217-226RARKSKGRKA
Subcellular Location(s) cysk 12, mito 7, cyto 4, mito_nucl 4
Family & Domain DBs
KEGG mpr:MPER_00633  -  
Amino Acid Sequences DRVSVDEENLIVKKMGLFATVFTRVDGTETYYFNSQLFNKFIGKQVVRTGDEYYGAEYXVPEVPELTIGMGHNAPWQTWALRVTGKTAFHAAVQYFCRQLGIIGFEAPFPIVWADEESGPYVPSEYDMSDIASVTSTGTTHGPGHAGGVVVSGDIDAEPERVAPGMPSTGVGLSAQLQQPMAPLEMHIHSPSPQPTPASTSLMGFKAPEVSVAAHLRARKSKGRKAILRGMDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.12
5 0.12
6 0.18
7 0.21
8 0.21
9 0.18
10 0.19
11 0.17
12 0.19
13 0.17
14 0.18
15 0.17
16 0.18
17 0.2
18 0.21
19 0.22
20 0.2
21 0.23
22 0.2
23 0.21
24 0.22
25 0.23
26 0.24
27 0.25
28 0.3
29 0.35
30 0.33
31 0.32
32 0.35
33 0.39
34 0.38
35 0.38
36 0.35
37 0.28
38 0.28
39 0.26
40 0.21
41 0.15
42 0.13
43 0.11
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.1
59 0.1
60 0.1
61 0.1
62 0.11
63 0.1
64 0.12
65 0.12
66 0.11
67 0.13
68 0.13
69 0.16
70 0.18
71 0.19
72 0.18
73 0.18
74 0.17
75 0.15
76 0.17
77 0.14
78 0.14
79 0.15
80 0.15
81 0.14
82 0.14
83 0.13
84 0.11
85 0.11
86 0.09
87 0.09
88 0.08
89 0.08
90 0.09
91 0.08
92 0.08
93 0.08
94 0.07
95 0.05
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.05
109 0.06
110 0.06
111 0.06
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.06
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.07
126 0.07
127 0.07
128 0.08
129 0.07
130 0.08
131 0.08
132 0.07
133 0.06
134 0.06
135 0.05
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.07
160 0.11
161 0.11
162 0.11
163 0.11
164 0.11
165 0.12
166 0.13
167 0.12
168 0.09
169 0.08
170 0.11
171 0.12
172 0.14
173 0.14
174 0.14
175 0.14
176 0.18
177 0.21
178 0.21
179 0.22
180 0.22
181 0.23
182 0.28
183 0.3
184 0.3
185 0.28
186 0.26
187 0.27
188 0.26
189 0.25
190 0.19
191 0.17
192 0.16
193 0.15
194 0.14
195 0.13
196 0.13
197 0.18
198 0.2
199 0.22
200 0.21
201 0.24
202 0.29
203 0.34
204 0.39
205 0.43
206 0.5
207 0.57
208 0.65
209 0.72
210 0.75
211 0.77
212 0.81