Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TKA6

Protein Details
Accession G4TKA6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-44DYASPPTKAPSKKRKLSTKATSSTKAKRVKKDPFADAKDHydrophilic
NLS Segment(s)
PositionSequence
13-36KAPSKKRKLSTKATSSTKAKRVKK
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSDSEDYASPPTKAPSKKRKLSTKATSSTKAKRVKKDPFADAKDAIRTTLASPDSFALPEDDGEIRRLVVGIAEYAQSLESITAAANAGRPGVAHKTAEEIAKEAERIATMINNGVRKQMPWKSTCKQGHALYVYDGVCTDPRVFGAVLGLDGPPTFKAKKYTINEFQACVGQIRAEVRYDSLVLTSGVNVRWNGETGQFKISGKYGVLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.62
4 0.7
5 0.78
6 0.84
7 0.85
8 0.87
9 0.87
10 0.86
11 0.84
12 0.81
13 0.79
14 0.77
15 0.76
16 0.75
17 0.74
18 0.72
19 0.73
20 0.76
21 0.79
22 0.81
23 0.8
24 0.8
25 0.8
26 0.78
27 0.73
28 0.65
29 0.58
30 0.53
31 0.45
32 0.36
33 0.27
34 0.22
35 0.18
36 0.21
37 0.2
38 0.15
39 0.15
40 0.16
41 0.16
42 0.15
43 0.15
44 0.11
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.09
80 0.1
81 0.1
82 0.1
83 0.12
84 0.14
85 0.15
86 0.13
87 0.11
88 0.11
89 0.11
90 0.11
91 0.08
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.07
99 0.09
100 0.11
101 0.11
102 0.13
103 0.13
104 0.13
105 0.19
106 0.23
107 0.25
108 0.27
109 0.34
110 0.34
111 0.45
112 0.47
113 0.46
114 0.47
115 0.44
116 0.47
117 0.42
118 0.4
119 0.3
120 0.31
121 0.26
122 0.19
123 0.18
124 0.12
125 0.11
126 0.11
127 0.11
128 0.07
129 0.07
130 0.09
131 0.09
132 0.08
133 0.09
134 0.07
135 0.07
136 0.07
137 0.07
138 0.05
139 0.05
140 0.06
141 0.06
142 0.09
143 0.1
144 0.12
145 0.18
146 0.22
147 0.32
148 0.36
149 0.45
150 0.5
151 0.58
152 0.57
153 0.53
154 0.5
155 0.43
156 0.38
157 0.3
158 0.21
159 0.13
160 0.13
161 0.14
162 0.14
163 0.13
164 0.13
165 0.14
166 0.15
167 0.15
168 0.13
169 0.12
170 0.11
171 0.11
172 0.1
173 0.1
174 0.11
175 0.12
176 0.15
177 0.14
178 0.16
179 0.16
180 0.18
181 0.18
182 0.22
183 0.25
184 0.25
185 0.28
186 0.29
187 0.28
188 0.29
189 0.29
190 0.25
191 0.22