Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VV02

Protein Details
Accession A0A4U0VV02    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
29-54APPAVASPTKKSKKDKKDKSGAAGAAHydrophilic
NLS Segment(s)
PositionSequence
38-47KKSKKDKKDK
75-110VKKTGKHVLRLVKKASKSRHLKRGVKEVVKSIRKGE
Subcellular Location(s) cyto 16, cyto_mito 11.666, cyto_nucl 11.166, mito_nucl 6.166, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MGKSSKRTLDQATASDAAAPAAMEVDSAAPPAVASPTKKSKKDKKDKSGAAGAAEGDDKEVGLEQLAEIAKPLAVKKTGKHVLRLVKKASKSRHLKRGVKEVVKSIRKGEKGIVVLAADISPLDILTHIPLLAEEANCPYIWVTSKESLGLASSTKRPTSCVMVAEKGMKRKAAKDGEAAKDDSKAKETEKEFQEEYAGVKKEVESMEVAIPTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.26
4 0.19
5 0.15
6 0.12
7 0.07
8 0.06
9 0.06
10 0.04
11 0.04
12 0.06
13 0.06
14 0.06
15 0.06
16 0.05
17 0.05
18 0.06
19 0.09
20 0.1
21 0.13
22 0.19
23 0.3
24 0.38
25 0.46
26 0.56
27 0.64
28 0.72
29 0.81
30 0.85
31 0.86
32 0.88
33 0.87
34 0.84
35 0.81
36 0.71
37 0.61
38 0.5
39 0.39
40 0.29
41 0.24
42 0.17
43 0.1
44 0.08
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.03
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.09
60 0.09
61 0.12
62 0.14
63 0.15
64 0.25
65 0.32
66 0.33
67 0.37
68 0.4
69 0.46
70 0.52
71 0.55
72 0.51
73 0.49
74 0.52
75 0.55
76 0.55
77 0.55
78 0.58
79 0.61
80 0.65
81 0.69
82 0.71
83 0.68
84 0.73
85 0.71
86 0.65
87 0.59
88 0.55
89 0.54
90 0.51
91 0.47
92 0.42
93 0.4
94 0.37
95 0.36
96 0.32
97 0.27
98 0.24
99 0.24
100 0.2
101 0.13
102 0.12
103 0.11
104 0.1
105 0.05
106 0.04
107 0.03
108 0.03
109 0.02
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.07
120 0.06
121 0.06
122 0.08
123 0.08
124 0.08
125 0.09
126 0.07
127 0.07
128 0.09
129 0.12
130 0.15
131 0.16
132 0.17
133 0.17
134 0.17
135 0.16
136 0.15
137 0.13
138 0.1
139 0.1
140 0.15
141 0.17
142 0.19
143 0.19
144 0.2
145 0.22
146 0.27
147 0.27
148 0.27
149 0.28
150 0.28
151 0.3
152 0.35
153 0.36
154 0.36
155 0.35
156 0.36
157 0.35
158 0.37
159 0.44
160 0.44
161 0.44
162 0.46
163 0.52
164 0.53
165 0.54
166 0.52
167 0.44
168 0.42
169 0.42
170 0.35
171 0.3
172 0.27
173 0.26
174 0.32
175 0.35
176 0.38
177 0.4
178 0.43
179 0.41
180 0.39
181 0.39
182 0.31
183 0.31
184 0.29
185 0.27
186 0.22
187 0.22
188 0.22
189 0.25
190 0.24
191 0.23
192 0.17
193 0.18
194 0.2