Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VXX1

Protein Details
Accession A0A4U0VXX1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHRNGIKKPKTQRYPSHydrophilic
NLS Segment(s)
PositionSequence
14-30KKAHRNGIKKPKTQRYP
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTQRYPSMRGVDPKFRRNARYAAQGTQKAIAAAKKEAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.85
8 0.83
9 0.81
10 0.82
11 0.83
12 0.81
13 0.79
14 0.78
15 0.76
16 0.74
17 0.74
18 0.7
19 0.61
20 0.59
21 0.57
22 0.57
23 0.53
24 0.51
25 0.52
26 0.5
27 0.51
28 0.48
29 0.51
30 0.45
31 0.5
32 0.47
33 0.46
34 0.49
35 0.49
36 0.46
37 0.42
38 0.38
39 0.29
40 0.28
41 0.25
42 0.21
43 0.2
44 0.23