Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VTZ3

Protein Details
Accession A0A4U0VTZ3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-39QTPKVEPQEKKKQPKGRAWKRHLYNHydrophilic
NLS Segment(s)
PositionSequence
23-35EKKKQPKGRAWKR
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MTLPFDCHLPPVKSQTPKVEPQEKKKQPKGRAWKRHLYNSRFVNATTQPGGKPAQRNKQPQGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.51
4 0.56
5 0.61
6 0.63
7 0.62
8 0.65
9 0.73
10 0.73
11 0.77
12 0.79
13 0.8
14 0.78
15 0.81
16 0.83
17 0.83
18 0.84
19 0.81
20 0.81
21 0.77
22 0.8
23 0.79
24 0.72
25 0.69
26 0.62
27 0.58
28 0.5
29 0.45
30 0.39
31 0.31
32 0.31
33 0.25
34 0.23
35 0.2
36 0.22
37 0.25
38 0.25
39 0.33
40 0.38
41 0.46
42 0.53
43 0.63
44 0.69
45 0.76