Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0W5F8

Protein Details
Accession A0A4U0W5F8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-34DIIGEKRKSRAPRRSRPAGGARKPBasic
NLS Segment(s)
PositionSequence
16-34KRKSRAPRRSRPAGGARKP
Subcellular Location(s) mito 11, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MSMNLDKPLDDIIGEKRKSRAPRRSRPAGGARKPSTGNVNNNNNGAAAAAPAPAVSGSVHVGDKIIVSGLPTDVNEAQVRELFQTTVGPLRSCVLTYDARGQFKGTATVHFRKAEHATKAYTEYNKRVVDGSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.39
5 0.49
6 0.57
7 0.6
8 0.61
9 0.71
10 0.78
11 0.84
12 0.82
13 0.8
14 0.81
15 0.8
16 0.77
17 0.77
18 0.7
19 0.64
20 0.61
21 0.55
22 0.53
23 0.49
24 0.49
25 0.47
26 0.52
27 0.5
28 0.49
29 0.47
30 0.39
31 0.32
32 0.24
33 0.15
34 0.08
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.06
60 0.06
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.09
69 0.08
70 0.07
71 0.08
72 0.08
73 0.11
74 0.12
75 0.11
76 0.11
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.13
83 0.15
84 0.24
85 0.27
86 0.28
87 0.28
88 0.28
89 0.27
90 0.26
91 0.3
92 0.22
93 0.23
94 0.29
95 0.33
96 0.37
97 0.38
98 0.38
99 0.37
100 0.43
101 0.44
102 0.44
103 0.42
104 0.4
105 0.39
106 0.43
107 0.44
108 0.45
109 0.44
110 0.43
111 0.48
112 0.46
113 0.45
114 0.42