Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0W6H8

Protein Details
Accession A0A4U0W6H8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
84-109LDMRAKKTRAIRRRLTKHERTQTTERHydrophilic
NLS Segment(s)
PositionSequence
78-119KGKKLPLDMRAKKTRAIRRRLTKHERTQTTERAHKKAIHFPK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSPQLKVRASELQNKKRDELVKQLEELKTELVSLRVQKIAGGNASKLARISTVRKSIARVLTVINHKTRANLRELYKGKKLPLDMRAKKTRAIRRRLTKHERTQTTERAHKKAIHFPKRQFIVKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.62
4 0.6
5 0.6
6 0.54
7 0.54
8 0.53
9 0.49
10 0.48
11 0.52
12 0.46
13 0.43
14 0.39
15 0.29
16 0.2
17 0.17
18 0.15
19 0.11
20 0.13
21 0.14
22 0.15
23 0.15
24 0.15
25 0.16
26 0.17
27 0.17
28 0.17
29 0.16
30 0.14
31 0.17
32 0.17
33 0.16
34 0.15
35 0.13
36 0.12
37 0.14
38 0.17
39 0.19
40 0.24
41 0.27
42 0.27
43 0.29
44 0.33
45 0.32
46 0.29
47 0.24
48 0.19
49 0.22
50 0.25
51 0.26
52 0.22
53 0.22
54 0.21
55 0.23
56 0.27
57 0.24
58 0.25
59 0.27
60 0.29
61 0.36
62 0.39
63 0.42
64 0.44
65 0.44
66 0.41
67 0.39
68 0.4
69 0.36
70 0.41
71 0.47
72 0.48
73 0.54
74 0.61
75 0.59
76 0.61
77 0.65
78 0.66
79 0.64
80 0.66
81 0.68
82 0.7
83 0.79
84 0.84
85 0.85
86 0.85
87 0.87
88 0.88
89 0.84
90 0.81
91 0.79
92 0.77
93 0.75
94 0.74
95 0.7
96 0.66
97 0.64
98 0.63
99 0.61
100 0.63
101 0.65
102 0.66
103 0.69
104 0.7
105 0.75
106 0.76