Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VMU4

Protein Details
Accession A0A4U0VMU4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-42TSPHKACRVKREPRVVVRSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_nucl 5.5, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034103  Lsm8  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005688  C:U6 snRNP  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01727  LSm8  
Amino Acid Sequences MHVSAQRDFGALRKRDATPLPETSPHKACRVKREPRVVVRSLSSGTANTRRDALTTYVDKKVLVVTQDGRVIVGKLMGFDQTTNIILADSIERIFSVDEPVIEEPLGVEIVRGDNITLIGGLDEEADKEIDLSTIRAHPLADVTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.43
4 0.42
5 0.38
6 0.42
7 0.42
8 0.44
9 0.47
10 0.47
11 0.5
12 0.48
13 0.49
14 0.51
15 0.52
16 0.56
17 0.63
18 0.67
19 0.69
20 0.77
21 0.77
22 0.79
23 0.8
24 0.72
25 0.65
26 0.56
27 0.49
28 0.4
29 0.33
30 0.24
31 0.18
32 0.19
33 0.24
34 0.23
35 0.22
36 0.22
37 0.21
38 0.21
39 0.22
40 0.21
41 0.18
42 0.21
43 0.24
44 0.25
45 0.25
46 0.24
47 0.22
48 0.21
49 0.17
50 0.13
51 0.12
52 0.11
53 0.13
54 0.14
55 0.14
56 0.13
57 0.12
58 0.11
59 0.09
60 0.08
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.1
87 0.1
88 0.1
89 0.1
90 0.09
91 0.07
92 0.07
93 0.08
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.1
121 0.12
122 0.14
123 0.14
124 0.14
125 0.14