Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5NBQ9

Protein Details
Accession A0A4V5NBQ9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MAATSIKIVKKRTKPFQKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
10-50KKRTKPFQKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQL
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATSIKIVKKRTKPFQKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHVLPCGYKKFLVHNERDLESLLMNSKVFAAEIASTVSARKRVTILEKARVLGVKVTNSQAKVRVEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.9
4 0.92
5 0.91
6 0.91
7 0.9
8 0.86
9 0.82
10 0.81
11 0.78
12 0.69
13 0.62
14 0.56
15 0.52
16 0.54
17 0.57
18 0.56
19 0.51
20 0.49
21 0.5
22 0.54
23 0.58
24 0.59
25 0.59
26 0.61
27 0.69
28 0.78
29 0.82
30 0.76
31 0.73
32 0.7
33 0.67
34 0.67
35 0.64
36 0.64
37 0.63
38 0.65
39 0.59
40 0.52
41 0.46
42 0.37
43 0.37
44 0.33
45 0.34
46 0.4
47 0.41
48 0.41
49 0.45
50 0.47
51 0.45
52 0.44
53 0.43
54 0.42
55 0.49
56 0.52
57 0.51
58 0.47
59 0.42
60 0.42
61 0.45
62 0.43
63 0.36
64 0.38
65 0.39
66 0.39
67 0.38
68 0.34
69 0.25
70 0.18
71 0.16
72 0.12
73 0.1
74 0.09
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.06
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.08
87 0.1
88 0.13
89 0.13
90 0.14
91 0.14
92 0.19
93 0.25
94 0.34
95 0.39
96 0.43
97 0.45
98 0.45
99 0.46
100 0.43
101 0.37
102 0.33
103 0.3
104 0.25
105 0.26
106 0.3
107 0.33
108 0.34
109 0.36
110 0.37
111 0.37