Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0W0T1

Protein Details
Accession A0A4U0W0T1    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-45PSPPLPSRIPAQRKPPKRRIPSSDAEEEHydrophilic
NLS Segment(s)
PositionSequence
28-36AQRKPPKRR
221-253PAGKPPVPKPNAARNPLNKIRSSKIAPGAPKPS
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTLNPETQQIDTAAPAAPSPPLPSRIPAQRKPPKRRIPSSDAEEEEERVVFAPPPEATNPPPEPGNAVLSVALDPVDTYSAPEPSAPAVPRPLDQVGTEVDRDSSSAIPLASPQDAPGPTKTPQPVTSLQAATPLGVQSGRAPAGGDDSMGATPVPVGETIGTPVAANLPLPAADQDLHAATSKEVSEETVSTEQQAAGTTSAGASSGSIAQPSPKPGQSPAGKPPVPKPNAARNPLNKIRSSKIAPGAPKPSSAGLKPTKSGAFNILEVLQPTAPAKPKPEQPVEARTAPPSLMPTQAEKEAEAKLMAAARIRERLARSDADSTSFDLLTQNYGIMRFEDEFREKVRRQHVEENNKYSGKHGLPRLTTFGSVFSLFPRSTGEGYEAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.12
5 0.12
6 0.16
7 0.19
8 0.22
9 0.24
10 0.27
11 0.33
12 0.42
13 0.51
14 0.53
15 0.6
16 0.66
17 0.75
18 0.83
19 0.87
20 0.87
21 0.88
22 0.91
23 0.89
24 0.87
25 0.86
26 0.83
27 0.8
28 0.72
29 0.66
30 0.57
31 0.49
32 0.42
33 0.32
34 0.25
35 0.17
36 0.16
37 0.12
38 0.12
39 0.14
40 0.13
41 0.16
42 0.18
43 0.21
44 0.22
45 0.29
46 0.3
47 0.29
48 0.29
49 0.26
50 0.27
51 0.26
52 0.27
53 0.19
54 0.17
55 0.16
56 0.15
57 0.15
58 0.12
59 0.09
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.08
66 0.09
67 0.1
68 0.11
69 0.11
70 0.11
71 0.12
72 0.17
73 0.15
74 0.16
75 0.19
76 0.21
77 0.21
78 0.25
79 0.24
80 0.2
81 0.2
82 0.2
83 0.18
84 0.18
85 0.18
86 0.14
87 0.14
88 0.12
89 0.12
90 0.12
91 0.1
92 0.08
93 0.09
94 0.09
95 0.08
96 0.09
97 0.11
98 0.11
99 0.1
100 0.1
101 0.13
102 0.14
103 0.16
104 0.18
105 0.19
106 0.19
107 0.25
108 0.27
109 0.26
110 0.27
111 0.3
112 0.31
113 0.31
114 0.35
115 0.3
116 0.27
117 0.27
118 0.25
119 0.2
120 0.18
121 0.14
122 0.1
123 0.09
124 0.09
125 0.07
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.11
132 0.11
133 0.09
134 0.07
135 0.08
136 0.07
137 0.07
138 0.07
139 0.04
140 0.04
141 0.04
142 0.04
143 0.03
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.07
170 0.07
171 0.07
172 0.06
173 0.07
174 0.07
175 0.07
176 0.1
177 0.1
178 0.1
179 0.1
180 0.11
181 0.1
182 0.09
183 0.09
184 0.07
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.04
191 0.04
192 0.03
193 0.03
194 0.05
195 0.05
196 0.05
197 0.05
198 0.07
199 0.08
200 0.12
201 0.14
202 0.14
203 0.16
204 0.17
205 0.25
206 0.27
207 0.3
208 0.33
209 0.39
210 0.4
211 0.4
212 0.45
213 0.48
214 0.46
215 0.45
216 0.44
217 0.46
218 0.53
219 0.56
220 0.57
221 0.52
222 0.59
223 0.62
224 0.6
225 0.53
226 0.49
227 0.47
228 0.46
229 0.44
230 0.41
231 0.39
232 0.4
233 0.39
234 0.41
235 0.44
236 0.39
237 0.36
238 0.32
239 0.29
240 0.27
241 0.25
242 0.28
243 0.28
244 0.29
245 0.29
246 0.31
247 0.31
248 0.3
249 0.3
250 0.27
251 0.22
252 0.2
253 0.21
254 0.19
255 0.16
256 0.16
257 0.16
258 0.11
259 0.09
260 0.1
261 0.12
262 0.15
263 0.16
264 0.2
265 0.24
266 0.31
267 0.38
268 0.43
269 0.45
270 0.47
271 0.53
272 0.54
273 0.52
274 0.46
275 0.4
276 0.36
277 0.3
278 0.26
279 0.22
280 0.18
281 0.18
282 0.18
283 0.2
284 0.22
285 0.25
286 0.24
287 0.22
288 0.22
289 0.2
290 0.2
291 0.16
292 0.14
293 0.12
294 0.13
295 0.13
296 0.14
297 0.15
298 0.17
299 0.21
300 0.21
301 0.24
302 0.25
303 0.29
304 0.31
305 0.31
306 0.32
307 0.33
308 0.33
309 0.32
310 0.31
311 0.28
312 0.26
313 0.23
314 0.2
315 0.16
316 0.16
317 0.14
318 0.13
319 0.12
320 0.11
321 0.11
322 0.12
323 0.11
324 0.13
325 0.13
326 0.15
327 0.2
328 0.23
329 0.25
330 0.28
331 0.36
332 0.36
333 0.42
334 0.5
335 0.52
336 0.56
337 0.65
338 0.71
339 0.74
340 0.8
341 0.79
342 0.76
343 0.7
344 0.63
345 0.54
346 0.52
347 0.46
348 0.45
349 0.45
350 0.46
351 0.48
352 0.51
353 0.55
354 0.5
355 0.46
356 0.39
357 0.34
358 0.28
359 0.25
360 0.22
361 0.19
362 0.22
363 0.2
364 0.2
365 0.22
366 0.23
367 0.22
368 0.23