Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VNG7

Protein Details
Accession A0A4U0VNG7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-127PGVGANRRPKKPKKERKRGSLPASSSBasic
176-203SGNASASAKPKKPKKEKKPEGALHKLTSHydrophilic
NLS Segment(s)
PositionSequence
107-120NRRPKKPKKERKRG
182-195SAKPKKPKKEKKPE
Subcellular Location(s) mito 19.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MMVPRMIMAQKGLHAGMLVDGIKHLNLSDGVEVYHLLFQDRAKAKLKVSLELAAELKGQTSAPSTSTSTVPATSTVPAMATSTAPATATLSGLTSAWHALFPGVGANRRPKKPKKERKRGSLPASSSTAPAGPSGSPPLSGPVPSSSATPQPLTPAPGASSALTPQWNTLFHRRSSGNASASAKPKKPKKEKKPEGALHKLTSFFGGPGTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.12
5 0.1
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.09
23 0.09
24 0.1
25 0.1
26 0.19
27 0.21
28 0.25
29 0.28
30 0.31
31 0.31
32 0.36
33 0.38
34 0.32
35 0.32
36 0.32
37 0.28
38 0.27
39 0.27
40 0.2
41 0.19
42 0.15
43 0.13
44 0.1
45 0.09
46 0.07
47 0.09
48 0.09
49 0.09
50 0.12
51 0.13
52 0.14
53 0.15
54 0.16
55 0.15
56 0.15
57 0.14
58 0.13
59 0.12
60 0.11
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.06
90 0.06
91 0.08
92 0.1
93 0.19
94 0.25
95 0.29
96 0.38
97 0.44
98 0.55
99 0.65
100 0.74
101 0.77
102 0.83
103 0.87
104 0.89
105 0.92
106 0.89
107 0.85
108 0.81
109 0.72
110 0.64
111 0.58
112 0.48
113 0.38
114 0.29
115 0.23
116 0.15
117 0.13
118 0.11
119 0.08
120 0.08
121 0.11
122 0.11
123 0.1
124 0.1
125 0.13
126 0.12
127 0.12
128 0.13
129 0.11
130 0.13
131 0.13
132 0.15
133 0.14
134 0.17
135 0.19
136 0.18
137 0.17
138 0.18
139 0.19
140 0.2
141 0.19
142 0.17
143 0.16
144 0.16
145 0.17
146 0.14
147 0.14
148 0.12
149 0.14
150 0.14
151 0.13
152 0.13
153 0.15
154 0.16
155 0.2
156 0.29
157 0.32
158 0.31
159 0.37
160 0.36
161 0.38
162 0.42
163 0.44
164 0.37
165 0.38
166 0.41
167 0.41
168 0.48
169 0.52
170 0.51
171 0.53
172 0.59
173 0.65
174 0.72
175 0.78
176 0.81
177 0.86
178 0.91
179 0.92
180 0.95
181 0.93
182 0.91
183 0.9
184 0.85
185 0.77
186 0.7
187 0.6
188 0.5
189 0.43
190 0.34
191 0.24
192 0.19