Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5NBP8

Protein Details
Accession A0A4V5NBP8   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
164-189IKATLEELRKRRRKRRTRGSAVPTTPHydrophilic
NLS Segment(s)
PositionSequence
144-181EVDPARRRAGKIAQFKMEKEIKATLEELRKRRRKRRTR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038511  TAP42/TAP46-like_sf  
IPR007304  TAP46-like  
Gene Ontology GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04177  TAP42  
Amino Acid Sequences MASTHDEAAESDLTLGQLLTRSLRHADKATNAPSPNDPAIQASTSLISTTLSDLTLCASLVSHLGVFSPNETLEDISTRDLRALLVPALEAQLCLLVRTKGGSQRLEWLHRAQTAFKRYVDSVEKYEVVGQDRRKTLAGPKAGEVDPARRRAGKIAQFKMEKEIKATLEELRKRRRKRRTRGSAVPTTPADLTSSLASTSISSTAKLAPPPVPPVTASSEGEEAEDFLSSDDDEGESVARPLLINLLTLHYLRAHAELDSIEQEIEILQHGIRMSEIPSSRPGARIEELGSEGHGASADSRTARGNEAGDVDDEERRWRLDVLPKEDGPVLSNDGKVLRPFTILPSKSGPLSTRLRLQSEVFRDGHRLPTMTIDEFLDREQERGNVLQGGGPSTSEAVEQAERDEQAEKEEDTVKGYEEEEKGLKKAREWDDYRDAHRKGEGNMHNRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.08
5 0.09
6 0.11
7 0.12
8 0.15
9 0.2
10 0.23
11 0.27
12 0.3
13 0.33
14 0.38
15 0.45
16 0.47
17 0.49
18 0.47
19 0.45
20 0.45
21 0.46
22 0.41
23 0.35
24 0.3
25 0.26
26 0.27
27 0.25
28 0.23
29 0.18
30 0.16
31 0.15
32 0.14
33 0.12
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.09
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.07
50 0.06
51 0.07
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.11
58 0.12
59 0.12
60 0.11
61 0.12
62 0.13
63 0.14
64 0.15
65 0.14
66 0.14
67 0.14
68 0.14
69 0.13
70 0.14
71 0.12
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.09
78 0.07
79 0.08
80 0.08
81 0.09
82 0.1
83 0.09
84 0.1
85 0.12
86 0.15
87 0.19
88 0.25
89 0.27
90 0.26
91 0.34
92 0.4
93 0.42
94 0.42
95 0.4
96 0.38
97 0.39
98 0.39
99 0.36
100 0.38
101 0.4
102 0.41
103 0.38
104 0.38
105 0.35
106 0.39
107 0.39
108 0.35
109 0.32
110 0.32
111 0.31
112 0.28
113 0.3
114 0.26
115 0.24
116 0.26
117 0.27
118 0.3
119 0.32
120 0.33
121 0.31
122 0.3
123 0.33
124 0.36
125 0.37
126 0.32
127 0.32
128 0.35
129 0.35
130 0.36
131 0.31
132 0.31
133 0.31
134 0.33
135 0.34
136 0.31
137 0.31
138 0.33
139 0.4
140 0.4
141 0.45
142 0.45
143 0.51
144 0.51
145 0.51
146 0.53
147 0.5
148 0.41
149 0.34
150 0.33
151 0.27
152 0.26
153 0.27
154 0.24
155 0.28
156 0.34
157 0.39
158 0.46
159 0.54
160 0.62
161 0.7
162 0.76
163 0.79
164 0.84
165 0.88
166 0.89
167 0.9
168 0.9
169 0.89
170 0.87
171 0.77
172 0.7
173 0.59
174 0.49
175 0.39
176 0.29
177 0.22
178 0.13
179 0.12
180 0.09
181 0.09
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.08
188 0.08
189 0.08
190 0.08
191 0.1
192 0.12
193 0.12
194 0.13
195 0.13
196 0.15
197 0.19
198 0.19
199 0.17
200 0.16
201 0.18
202 0.21
203 0.21
204 0.2
205 0.17
206 0.17
207 0.16
208 0.16
209 0.13
210 0.09
211 0.07
212 0.06
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.06
230 0.05
231 0.06
232 0.06
233 0.07
234 0.08
235 0.08
236 0.09
237 0.07
238 0.08
239 0.08
240 0.09
241 0.08
242 0.07
243 0.08
244 0.08
245 0.08
246 0.09
247 0.08
248 0.07
249 0.06
250 0.06
251 0.05
252 0.05
253 0.05
254 0.04
255 0.04
256 0.05
257 0.06
258 0.06
259 0.06
260 0.06
261 0.07
262 0.11
263 0.12
264 0.12
265 0.14
266 0.17
267 0.18
268 0.2
269 0.21
270 0.2
271 0.2
272 0.2
273 0.19
274 0.17
275 0.18
276 0.15
277 0.14
278 0.11
279 0.1
280 0.08
281 0.07
282 0.06
283 0.05
284 0.06
285 0.07
286 0.07
287 0.08
288 0.09
289 0.1
290 0.12
291 0.13
292 0.13
293 0.13
294 0.14
295 0.14
296 0.13
297 0.13
298 0.13
299 0.13
300 0.12
301 0.13
302 0.13
303 0.13
304 0.13
305 0.13
306 0.17
307 0.24
308 0.32
309 0.37
310 0.42
311 0.41
312 0.42
313 0.42
314 0.37
315 0.3
316 0.24
317 0.21
318 0.17
319 0.17
320 0.16
321 0.16
322 0.18
323 0.18
324 0.18
325 0.14
326 0.14
327 0.15
328 0.2
329 0.28
330 0.27
331 0.29
332 0.31
333 0.32
334 0.31
335 0.33
336 0.28
337 0.25
338 0.3
339 0.31
340 0.34
341 0.37
342 0.39
343 0.39
344 0.4
345 0.42
346 0.41
347 0.44
348 0.37
349 0.35
350 0.37
351 0.36
352 0.39
353 0.33
354 0.29
355 0.23
356 0.27
357 0.3
358 0.26
359 0.26
360 0.21
361 0.2
362 0.2
363 0.2
364 0.2
365 0.17
366 0.17
367 0.17
368 0.17
369 0.18
370 0.19
371 0.2
372 0.16
373 0.16
374 0.17
375 0.16
376 0.17
377 0.15
378 0.13
379 0.12
380 0.11
381 0.11
382 0.09
383 0.09
384 0.1
385 0.11
386 0.11
387 0.13
388 0.15
389 0.15
390 0.16
391 0.18
392 0.16
393 0.18
394 0.21
395 0.19
396 0.19
397 0.23
398 0.22
399 0.22
400 0.23
401 0.21
402 0.19
403 0.2
404 0.23
405 0.2
406 0.24
407 0.25
408 0.27
409 0.29
410 0.35
411 0.36
412 0.34
413 0.43
414 0.46
415 0.52
416 0.54
417 0.59
418 0.61
419 0.65
420 0.69
421 0.68
422 0.62
423 0.55
424 0.57
425 0.52
426 0.46
427 0.51
428 0.52