Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W0R2

Protein Details
Accession A0A4U0W0R2   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
171-192DGNNFRGKRPPRAPRPRQELEMHydrophilic
529-570KDSADEEKRTRREKKQARKDEKEAKMKKKKKPAQEIPADSLVBasic
NLS Segment(s)
PositionSequence
177-186GKRPPRAPRP
536-560KRTRREKKQARKDEKEAKMKKKKKP
600-629KEAERRAKLEKANRAAAIAKKREGTAAPRR
Subcellular Location(s) mito 15, mito_nucl 11.666, cyto_mito 10.666, nucl 7, cyto_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007811  RPC4  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0003677  F:DNA binding  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF05132  RNA_pol_Rpc4  
Amino Acid Sequences MSGRGRGRGRRVAAQTLSGAAAITAAGGAGPSPSPAPERSAASSRASSTAESTPAPPPGATDDAPNDASGGRGGGDKPARAAAGVRRVPSVGVGSTRAPSVGLLARTPSIGPPGVGTMRERPVGGLLGSTSEFRPSANAGTSSGKAKFKPNMKRRDKALEVSDDEDVKMEDGNNFRGKRPPRAPRPRQELEMTASGPMAQGPGGPPRAWGARPAAGGSSGAAVMAASRAGTLNQMLDADSDASDLEVDDDPLLDEGSGALRFKAVDLNDIGTVTSPDDTTLPPLTLPRDPKVKAKSEGALAGVKPEPGDESMPTSATATPAPIDSKEGSLALFSVDEEKEAKDLRDLEQEEKKEIILSEAFDLAASPARDPGSSFFLLANKLTKEPGTTSSLADLSLADGAGVKGDPDAPPPRRKAAPPPWGRFGTMQEKAARWSEHAGRIGELCVHQSGKVTLRLAGDLRYEVLPAAQPSFLQEIAVLDHPSKRPATASGTNGSKSRHESSDSASEASDSDSDVSRSSISSLSDLDGKDSADEEKRTRREKKQARKDEKEAKMKKKKKPAQEIPADSLVLLGQTSKKFIVVPDMQDLLDKVGQEERAEKEAERRAKLEKANRAAAIAKKREGTAAPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.49
3 0.42
4 0.37
5 0.28
6 0.22
7 0.13
8 0.11
9 0.07
10 0.06
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.04
18 0.05
19 0.06
20 0.08
21 0.12
22 0.13
23 0.18
24 0.21
25 0.25
26 0.29
27 0.34
28 0.35
29 0.37
30 0.38
31 0.35
32 0.35
33 0.32
34 0.28
35 0.27
36 0.26
37 0.25
38 0.23
39 0.24
40 0.24
41 0.26
42 0.26
43 0.22
44 0.21
45 0.23
46 0.26
47 0.24
48 0.24
49 0.24
50 0.27
51 0.27
52 0.26
53 0.21
54 0.17
55 0.17
56 0.13
57 0.11
58 0.07
59 0.09
60 0.09
61 0.16
62 0.19
63 0.19
64 0.21
65 0.22
66 0.22
67 0.2
68 0.23
69 0.23
70 0.3
71 0.33
72 0.32
73 0.31
74 0.32
75 0.31
76 0.3
77 0.25
78 0.17
79 0.15
80 0.17
81 0.17
82 0.18
83 0.18
84 0.16
85 0.14
86 0.12
87 0.13
88 0.15
89 0.15
90 0.14
91 0.16
92 0.16
93 0.17
94 0.17
95 0.15
96 0.14
97 0.13
98 0.13
99 0.12
100 0.15
101 0.16
102 0.17
103 0.19
104 0.21
105 0.24
106 0.25
107 0.24
108 0.21
109 0.21
110 0.21
111 0.18
112 0.13
113 0.1
114 0.11
115 0.11
116 0.12
117 0.11
118 0.11
119 0.11
120 0.1
121 0.12
122 0.12
123 0.14
124 0.15
125 0.16
126 0.17
127 0.2
128 0.22
129 0.23
130 0.26
131 0.27
132 0.26
133 0.32
134 0.36
135 0.42
136 0.52
137 0.58
138 0.64
139 0.7
140 0.75
141 0.74
142 0.77
143 0.73
144 0.68
145 0.64
146 0.6
147 0.54
148 0.49
149 0.45
150 0.35
151 0.31
152 0.25
153 0.19
154 0.12
155 0.1
156 0.09
157 0.1
158 0.12
159 0.17
160 0.23
161 0.24
162 0.26
163 0.33
164 0.36
165 0.43
166 0.51
167 0.57
168 0.61
169 0.71
170 0.8
171 0.82
172 0.87
173 0.81
174 0.76
175 0.69
176 0.62
177 0.54
178 0.48
179 0.38
180 0.29
181 0.24
182 0.19
183 0.16
184 0.12
185 0.08
186 0.05
187 0.05
188 0.06
189 0.1
190 0.12
191 0.12
192 0.13
193 0.15
194 0.18
195 0.18
196 0.19
197 0.19
198 0.2
199 0.21
200 0.21
201 0.19
202 0.16
203 0.16
204 0.13
205 0.1
206 0.06
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.06
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.06
240 0.04
241 0.03
242 0.03
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.06
250 0.09
251 0.08
252 0.1
253 0.1
254 0.12
255 0.12
256 0.12
257 0.11
258 0.08
259 0.08
260 0.07
261 0.06
262 0.05
263 0.05
264 0.06
265 0.06
266 0.09
267 0.09
268 0.09
269 0.08
270 0.1
271 0.12
272 0.15
273 0.18
274 0.18
275 0.24
276 0.25
277 0.32
278 0.37
279 0.4
280 0.39
281 0.39
282 0.37
283 0.33
284 0.32
285 0.27
286 0.22
287 0.17
288 0.16
289 0.14
290 0.12
291 0.1
292 0.09
293 0.08
294 0.08
295 0.09
296 0.07
297 0.09
298 0.1
299 0.1
300 0.1
301 0.1
302 0.1
303 0.1
304 0.09
305 0.07
306 0.07
307 0.07
308 0.08
309 0.07
310 0.09
311 0.09
312 0.09
313 0.09
314 0.09
315 0.08
316 0.08
317 0.07
318 0.05
319 0.05
320 0.04
321 0.06
322 0.06
323 0.06
324 0.07
325 0.07
326 0.09
327 0.09
328 0.09
329 0.09
330 0.11
331 0.12
332 0.18
333 0.2
334 0.23
335 0.27
336 0.28
337 0.27
338 0.26
339 0.24
340 0.19
341 0.17
342 0.14
343 0.1
344 0.1
345 0.09
346 0.09
347 0.09
348 0.08
349 0.08
350 0.06
351 0.08
352 0.08
353 0.07
354 0.09
355 0.09
356 0.09
357 0.1
358 0.12
359 0.14
360 0.14
361 0.14
362 0.14
363 0.15
364 0.16
365 0.16
366 0.17
367 0.13
368 0.13
369 0.13
370 0.13
371 0.13
372 0.13
373 0.16
374 0.18
375 0.18
376 0.18
377 0.19
378 0.18
379 0.17
380 0.15
381 0.12
382 0.07
383 0.06
384 0.06
385 0.04
386 0.04
387 0.04
388 0.04
389 0.04
390 0.04
391 0.04
392 0.05
393 0.05
394 0.1
395 0.18
396 0.23
397 0.29
398 0.32
399 0.37
400 0.39
401 0.42
402 0.48
403 0.51
404 0.56
405 0.59
406 0.62
407 0.63
408 0.61
409 0.6
410 0.51
411 0.47
412 0.45
413 0.38
414 0.37
415 0.33
416 0.32
417 0.33
418 0.35
419 0.3
420 0.23
421 0.25
422 0.26
423 0.29
424 0.32
425 0.3
426 0.27
427 0.27
428 0.26
429 0.22
430 0.18
431 0.14
432 0.12
433 0.12
434 0.11
435 0.12
436 0.14
437 0.16
438 0.19
439 0.18
440 0.2
441 0.2
442 0.22
443 0.21
444 0.2
445 0.18
446 0.15
447 0.16
448 0.13
449 0.12
450 0.1
451 0.1
452 0.1
453 0.1
454 0.11
455 0.09
456 0.09
457 0.11
458 0.14
459 0.13
460 0.11
461 0.1
462 0.09
463 0.11
464 0.13
465 0.12
466 0.11
467 0.15
468 0.16
469 0.19
470 0.19
471 0.18
472 0.17
473 0.2
474 0.27
475 0.28
476 0.31
477 0.34
478 0.37
479 0.38
480 0.39
481 0.37
482 0.33
483 0.33
484 0.34
485 0.3
486 0.32
487 0.32
488 0.34
489 0.4
490 0.38
491 0.33
492 0.29
493 0.26
494 0.22
495 0.22
496 0.17
497 0.1
498 0.09
499 0.1
500 0.1
501 0.11
502 0.11
503 0.1
504 0.1
505 0.11
506 0.12
507 0.12
508 0.13
509 0.13
510 0.13
511 0.17
512 0.16
513 0.17
514 0.16
515 0.15
516 0.14
517 0.14
518 0.16
519 0.18
520 0.21
521 0.24
522 0.33
523 0.41
524 0.49
525 0.57
526 0.64
527 0.7
528 0.77
529 0.83
530 0.85
531 0.89
532 0.91
533 0.91
534 0.92
535 0.91
536 0.9
537 0.9
538 0.88
539 0.88
540 0.89
541 0.89
542 0.88
543 0.89
544 0.87
545 0.87
546 0.89
547 0.88
548 0.88
549 0.89
550 0.86
551 0.81
552 0.75
553 0.64
554 0.53
555 0.42
556 0.31
557 0.21
558 0.14
559 0.09
560 0.11
561 0.12
562 0.15
563 0.15
564 0.16
565 0.17
566 0.17
567 0.25
568 0.25
569 0.28
570 0.31
571 0.32
572 0.31
573 0.31
574 0.31
575 0.26
576 0.22
577 0.18
578 0.15
579 0.17
580 0.19
581 0.2
582 0.24
583 0.24
584 0.26
585 0.27
586 0.27
587 0.31
588 0.38
589 0.45
590 0.44
591 0.43
592 0.45
593 0.51
594 0.59
595 0.6
596 0.61
597 0.61
598 0.64
599 0.61
600 0.59
601 0.57
602 0.56
603 0.56
604 0.53
605 0.5
606 0.46
607 0.46
608 0.47
609 0.46