Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VM28

Protein Details
Accession A0A4U0VM28    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-66EQEQREQERKRKEQERREKLYGTBasic
NLS Segment(s)
PositionSequence
52-60RKRKEQERR
196-203VKGKGKGK
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR014906  PRP4-like  
IPR036285  PRP4-like_sf  
IPR039979  PRPF18  
Gene Ontology GO:0110165  C:cellular anatomical entity  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08799  PRP4  
Amino Acid Sequences MDFLKNEIASKKRQLDQVTASLSPSPDAPPPPKYLKRAELERIEQEQREQERKRKEQERREKLYGTKANTTKKSGARSSTDAATDGATTTTNTTDQEASTRNADAGGPGPTPGETFFVSNEEAVRRLRQKGQPIRLFAESDKDRRLRLRALELIEDSSSNTAVGQRNEFAKAMEGQELGLELDKVAKRAAGGGGDVKGKGKGKGSAVVGTPDPDPAAGLAEDKGKGKGESADEADREPNPKDQDVLVDLDLVRTNPHKVYPQIYHAFKRVLKEWEQSLADRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.57
4 0.58
5 0.53
6 0.46
7 0.42
8 0.38
9 0.34
10 0.27
11 0.22
12 0.18
13 0.17
14 0.23
15 0.26
16 0.28
17 0.34
18 0.43
19 0.49
20 0.52
21 0.56
22 0.58
23 0.62
24 0.65
25 0.66
26 0.65
27 0.63
28 0.64
29 0.62
30 0.58
31 0.51
32 0.46
33 0.46
34 0.45
35 0.49
36 0.49
37 0.51
38 0.58
39 0.65
40 0.72
41 0.74
42 0.78
43 0.8
44 0.85
45 0.87
46 0.86
47 0.83
48 0.78
49 0.72
50 0.72
51 0.67
52 0.61
53 0.59
54 0.56
55 0.59
56 0.58
57 0.59
58 0.56
59 0.54
60 0.56
61 0.52
62 0.5
63 0.47
64 0.48
65 0.45
66 0.4
67 0.36
68 0.3
69 0.26
70 0.21
71 0.16
72 0.12
73 0.09
74 0.07
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.1
81 0.1
82 0.1
83 0.12
84 0.14
85 0.14
86 0.15
87 0.15
88 0.13
89 0.12
90 0.12
91 0.1
92 0.09
93 0.1
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.09
101 0.08
102 0.08
103 0.08
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.1
110 0.11
111 0.14
112 0.15
113 0.18
114 0.25
115 0.28
116 0.37
117 0.44
118 0.53
119 0.54
120 0.54
121 0.54
122 0.49
123 0.46
124 0.36
125 0.35
126 0.28
127 0.26
128 0.27
129 0.26
130 0.25
131 0.27
132 0.29
133 0.25
134 0.25
135 0.28
136 0.28
137 0.28
138 0.28
139 0.26
140 0.24
141 0.2
142 0.18
143 0.13
144 0.09
145 0.07
146 0.06
147 0.05
148 0.08
149 0.11
150 0.12
151 0.13
152 0.14
153 0.15
154 0.17
155 0.17
156 0.14
157 0.12
158 0.13
159 0.13
160 0.12
161 0.11
162 0.1
163 0.09
164 0.09
165 0.08
166 0.06
167 0.05
168 0.04
169 0.09
170 0.09
171 0.1
172 0.1
173 0.1
174 0.1
175 0.11
176 0.12
177 0.08
178 0.09
179 0.1
180 0.11
181 0.12
182 0.13
183 0.12
184 0.15
185 0.16
186 0.17
187 0.18
188 0.2
189 0.21
190 0.26
191 0.28
192 0.27
193 0.26
194 0.27
195 0.24
196 0.22
197 0.2
198 0.15
199 0.13
200 0.1
201 0.09
202 0.07
203 0.08
204 0.07
205 0.07
206 0.08
207 0.1
208 0.11
209 0.12
210 0.14
211 0.14
212 0.14
213 0.15
214 0.18
215 0.19
216 0.21
217 0.25
218 0.27
219 0.26
220 0.27
221 0.28
222 0.26
223 0.26
224 0.24
225 0.26
226 0.27
227 0.27
228 0.27
229 0.25
230 0.27
231 0.26
232 0.27
233 0.21
234 0.19
235 0.18
236 0.18
237 0.18
238 0.15
239 0.15
240 0.14
241 0.17
242 0.17
243 0.21
244 0.25
245 0.28
246 0.35
247 0.38
248 0.44
249 0.5
250 0.54
251 0.55
252 0.54
253 0.57
254 0.52
255 0.53
256 0.5
257 0.48
258 0.47
259 0.48
260 0.47
261 0.48
262 0.48